current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1o0x_A mol:protein length:262 Methionine aminopeptidase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MGSDKIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKEGLast
1 -118.0001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model  100  1MGSDKIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKEG 256
2 -112.0003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  38  2...PGSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIP-NDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTISKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLS. 253
3 -111.0004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  42  1.....MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLR. 251
4 -110.0003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  43  1......MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAQIGYEGYKYATCCSINDEICHGFP-RKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYGVVRDFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNTGTWRMKMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTSQG 249
5 -110.0004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  39  1.....MTVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVEQKAIPAPLNYKGFPKSICTSINHVVCHGIP-NEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRN 251
6 -109.0001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  36  36....GSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIP-DSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTC.. 284
7 -109.0001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  33  1.......MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSK-RVIREGDLVNIDVSALKNGYYADTGISFVVGESDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIE 250
8 -109.0003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  36  35AAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIP-DSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTC.. 287
9 -109.0003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  40  23....KKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRARAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMR. 279
10 -108.0004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  36  46....TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIP-DRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRR. 295
11 -107.0002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  36  64....TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIP-DRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRR. 313
12 -105.0004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  42  1......MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFLPLQIGVDGYPYATCCSLNDEVAHAFP-RHYILKDGDLLKVDMVLGGPGGLADSCWAYAVGTPSEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPNYGIAGRGLRLREGMVLTIEPMINTGDWEIDTMKTGWAHKTIDGGLSCQYEHQFVITKDGPVILTSQG 281
13 -105.0004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  31  55.NIQFLHDDSKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIP-DSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANNKSLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDW. 307
14 -99.3004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  36  125....TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIP-DRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRR. 374
15 -95.7003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  35  92....KSDIYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIP-DYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNPTVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTKR. 344
16 -69.8002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  28  2..............DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPA------FP--VNLSINEIAAHYTPGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGM---EEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRNGIVAQFEHTIIVEKDSVIVTQD.. 295
17 -61.5003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  21  31.SRNMEIENFTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGERNNGI-GFP--AGMSMNSCAAHYTVEQDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFKE---NLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYPIRPISDLHGHSISQFRIHGGISIPAVNNRDTTRIKGDSFYAVETFATTGKGSIDDRPPCSHFVLNTGCKVAQFEHTVYLSEHGKEVLTR.. 354
18 -61.2001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  20  152.SEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVH--DDMECSHYMKNFDVGHVPIRLPRTKHLLNVINEN. 409
19 -60.5005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  23  46.SEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHLCDIKGSYTAQFEHTILLRPTCKEVVSR.. 368
20 -59.6002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  21  3.......QTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKKGIAFPTSISVNNCVCHFSPDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITS.. 328
21 -57.6002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  20  5.EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKKGIAFPTSISVNNCVCHFSPDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITS.. 336
22 -53.6004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  18  6.EKKEADNVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSYRDKKTNKGFSHPTTVSPAAFITPYTPLRATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDRQADLFLATYYANEVLLRLMVPPGLLAKISSLLEKVAKAYDCNIIESTTSWLFDKEIEGKKKIILSPNIKGEGVPEVGDVWGVEVGCSLGSGKVKQFEQRATLHRRTNAPVCRLLTTIAITKNGITRIGG.. 355
23 -53.6005fl8_u mol:protein length:380 ARX1  ali model follow..  14  3.......KNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPDVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPLLGGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEFPSDDFVVQSGEVYLIDLKMASLEHKAGELIARPGAYVRDSTLVARECNTIVLCDSSVSTTDR.. 341
24 -49.3005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  16  35........NILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPDAVAAAHIAMETVVALLASGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEREYKGVVWTESHQEADLLSNTDAKDLTVVQSTPFTNVSAIPSDDFVVQSGEVYLID......... 337
25 -48.6004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  15  26.QILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLIQRQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIACALTPEKLPASLGGTSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEREYKGVVWTESHQEADLLSNTDAKDLT-VVDRGQSTPFTNVSAIPSDDFVVQSGEVYLIDLKMAS 340
26 -45.1005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  29  118.GTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESA------FELIVASGPNGAKPHGHASK-RVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGAFAHSLGHGVGLEVHEGPGL----RGTSQDVLEAGMVITIEPGAYL-----------------PGVGGVRIEDLILVTEDGYEVLSH.. 343
27 -45.0001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  29  116.DVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKP-----AFDTIIASGHRSALPHGVASD-KRIERGDLVVIDLGALYNHYNSDITRTIVVGSPNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGYFIHSLGHGVGLEIHEWPRI----SQYDETVLKEGMVITIEPGIYI-----------------PKLGGVRIEDTVLITENGAKRLTK.. 342
28 -44.7001wn1_A mol:protein length:356 dipeptidase  ali model follow..  26  123.SLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIA------FEPIVASGENAANPHHEPGE-RKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGYFIHRTGHGLGLDVHEEPYI----GPDGEVILKNGMTFTIEPGIYV-----------------PGLGGVRIEDDIVVDEGKGRRLTK.. 348
29 -44.7001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  29  119.DVIRDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKP-----AFDTIIASGYRSALPHGVASD-KRIERGDLVVIDLGALYQHYNSDITRTIVVGSPNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGYFNHSLGHGVGLEVHEWPRV----SQYDETVLREGMVITIEPGIYI-----------------PKIGGVRIEDTILITKNGSKRLTK.. 345
30 -44.3002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  25  125.DEVKQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGV-----AFDTIVASGCRSALPHGKASD-KVVERGDVIVIDFGATYENYCADITRVVSIGEPSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGFFGHSLGHGIGLEVHEGPAI----SFRNDSPLPENVVFTVEPGIYL-----------------EGKFGIRIEEDVVLKEQGCEILTT.. 351
31 -44.1003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  26  122.GLVEKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSS-----SFDIIVASGLRSALPHGVASE-KVIETGDFVTLDFGAYYKGYCSDITRTIAVGEPSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGYFGHSTGHGIGLEIHEAPGL----AFRSDTVLEPGMAVTVEPGIYI-----------------PGIGGVRIEDDIIVTSEGNEVITK.. 348
32 -44.0004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  24  136.PVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDV----SFEPIVASGPNGANPHHRPSH-RKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGYFIHRTGHGLGIDVHEEPYI----SPGNKKILKDGMVFTIEPGIYL-----------------QGKFGVRIEDDVALVDKKGIRLTN.. 363
33 -43.4004zng_C mol:protein length:362 Prolidase  ali model follow..  25  126.PLIERMRLIKSADEIEKMKVAGDFADKCFEIGTAAERNGVTESDIVAKIEYEMKRMGVPQM-----SFDTLVLSGARAANPHGAPEN-VEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGYFNHRLGHGIGMDVHEYPSI----VAGNDLVIQEGMCFSNEPGIYI-----------------PGKVGVRIEDCLYVTENGCESFTH.. 354
34 -43.3004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  20  159.AIIDGCRMCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNG-----STFCIVQFGHATAFPHGIPGV-QHLRAGELVLIDTGCTVQGYHSDITRTWIYGTPSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGGLPHRTGHGCGLAIHEAPYL----VRGNRQPLQPGMCASNEPMIVV-----------------PGAFGVRLEDHFYVTDTGAQWFTPPS 392
35 -42.3005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  24  119.ATPDVLRQIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKA-----SFDTIVASGWRGALPHGKASD-KIVAAGEFVTLDFGALYQGYCSDMTRTLLVNAESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGYFGHNTGHAIGIEVHEDPRF----SPRDTTTLQPGMLLTVEPGIYL-----------------PGQGGVRIEDVVLVTPQGAEVLYA.. 350
36 -42.2001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  19  149.AACMRMRMIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTEDVELMDTWTWFQSGINTDGAHNPVTT-RKVNKGDILSLNCFPMIAGYYTALERTLFLDHCSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLQYRTFYGHSFGTLSHYYGREAGLEREDIDTVLEPGMVVSMEPMI-------------MLPEGLPGAGGYREHDILIVNENGAENITK.. 390
37 -41.6001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  19  157.........IKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXPYVELMDTWIWFQSGINTDGAHNPVTX-RVVXRGDILSLNCFPMIFGYYTALERTLFLXXVXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFYGHSFGVLXHYYGREAGVEREDIXTVLEPGMVVSMEPMV-------------MXPEGEPGAGGYREHDILVIKENXTENITG.. 390
38 -40.0004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  24  142.DVLRQLRMVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAFVI------VGSGPHGADPHHGYSD-RKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGDPSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAYFVHRTGHGIGLCVHEEPYI----VAGNELPLVAGMAFSIEPGIYF-----------------PGRWGARIEDIVVVTENGALSVNN.. 368
39 -38.8005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  14  139.ADLLQAFLVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAAGMQAG------HDVNVSFGVNAADSHYEPSEQRTLHPGECVLIDLWAQEPGRFADVTWVGFAGEPGTEYLDAWQAVRAAREAALELLRSRFVAEELDRAARDAMGERWAPHFLHRTGHDLGVQIHGAGANLDDYETRDTRTLTPGLSVTVEPGTYPAA----------ASPSGQGGFGIRSEVDVYLAPDGPEVTTD.. 392
40 -36.7004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  20  198.EVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVGDDDIWAVLHAENIKRGGEWIETRL------LASGPRTNPWFQECGP-RITQKNEIIAFDTDLISYGICVDISRTWWIGDQKPRPDMVMQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDDKFQAQKYGCL-MHGVGLC-DEWPLVAY--PGSYDYPLEPGMVLCVEAAVGE----------------VGGDFSIKLEDQVLITEDGYENLTT.. 436
41 -35.8004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  22  215.EVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEWIETRL------LASGPRSNPWFQECGP-RVCQRNEIISFDTDLVAYGICTDISRSWWIGDQKPRADMIYAMQHEHIRTNMEMLKPGVMIPELSA--NTHVLDAKFQ---GCLMHGVGLC-DEWPLVAY--AGAYDYPLEPGMTLCVEALISE----------------EGGDFSIKLEDQVLITEDGYENLTK.. 453
42 -35.6005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  13  192....SALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKEETEKVILDPAKVNCKLKADNYPPIFQSGGKFDLRPSAVSNDEALDSASVIICAVGARYKSYCSNIARTFLIDA-DPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDAPDMVSCLAGTGIGIEFRESGLNIN---AKNDQIVKEGMVFNVSLGFQN--------LHCENSKSKNKVFSLLLADTIIINKDKTDVVTS.. 445
43 -35.0005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  15  169....AYTIAVKEDGELNLMKKAASITSEVFNKFDEKVRHSKLAESVEKAIEEKKYLAGADPSTVEM-CYPPIIQSGGNYNLKFSVVSDKN-HMHFGAITCAMGIRFKSYCSNLVRTLMVDP-SQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKILGFGMGIEFREGSLVIN---SKNQYKLKKGMVFSINL-------GFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSV 421
44 -34.8005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  20  170....HDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKGGAK-----MPAYGSIVAAGRNACILHYREND-AAIKDGDLILIDAGCEIDCYASDITRTFPAGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGRLGLLEG-AGHWLGMDVHD---VGEYRVGGEWRVLEPGMAMTVEP-------GIYIAPDNTTVAKKWRGIGVRIEDDVVVTRNGCEVLTNG. 424
45 -34.8004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  21  168....HEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGAR-----YPAYNTIVGGGENGCILHYTENE-CELRDGDLVLIDAGCEYRGYAGDITRTFPVGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGELGILKG-LSHWLGMDVHD---VGDYGSSDRGRILEPGMVLTVEPGL--------YIAPDADVPPQYRGIGIRIEDDIVITATGNENLTAS. 421
46 -34.7006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  11  171....SSLWAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKSRFLKKLS---AYSPIIQSGPKYDLRVSARSSETQLDGNGCILASCGIRYKNYCSNISRTFLIDP-SDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSKKPELSAGFVGSLMGLEFRDSQFVLN--NKNDYRKVENGDCFNISLGFNNLKDS-----------KTGASYALQLADTVQLTSGGPKVLTN.. 433
47 -34.2004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  19  152IDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVP------YSNIVALNEHAAVLHYTKLDHQAPEEMRSFLLDAGAEYNGYAADLTRTWS-AKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLKHQIITD-IGHPLGLQVHDLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKHFNWQKGIRIEDNVVIHENNVENMTR.. 438
48 -33.9005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  19  190....QRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGAD-----ILAYPPVVAGGNRSNTLHYVKNN-QLIKDGEMVLLDGGCESSCYVSDITRTWPVGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKDLGIMKN-VGHYLGMDVHDTPDM------PRSLPLQPGMVITIEP-------GIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSAD. 440
49 -33.7001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  21  170....HEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGAR-----YPSYNTIVGSGENGCILHYTENE-CEMRDGDLVLIDAGCEYKGYAGDITRTFPVGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGKLGILKG-LSHWLGLDVHDVGVY----GQDRSRILEPGMVLTVEPGL--------YIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTAS. 422
50 -33.6003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  22  166....CELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIK-----HHAFNTILASGKNATVLHYEDND-AQIQNGDLVLLDLGAQKDYYNADISYTFPAGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGAVGLIQE-VSHFLGLDTHDVGTY-------KDRVLEEGMVITIEP-----------------LYIEEESIGIRIEDDILVTKDGHENLSKD. 400
51 -33.2003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  15  172....AKCLAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNEAFFQTKSLKLGYTPIIQSGGSYDLKPSAITDDR-NLHGDVVLCSLGFRYKSYCSNVGRTYLFDP-DSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKRPDLEPNFLGAGIGIEFRESSLLVN---AKNPRVLQAGMTLNLSI-------GFGNLINPHPKNSQSKEYALLLIDTIQITRSDPIVFTD.. 429
52 -33.0002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  20  187.........FKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGG----MRHSSYTCICGSGENSAVLH--APNDRTIQNGDMCLFDMGGEYYCFASDITCSFPAGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEEHMGILSG-LGHFLGIDVHDRIDEPGLRSLRTARHLQPGMVLTVEPGIALADPARASFFNREVLQRFRGFGGVRIEEDVVVTDSGIELLTC.. 468
53 -32.4003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  17  159.........YKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDNP------YGNIVALNENCAILHYTHFDRVAPATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCHQRVAQTDFNIVDL-LGHHIGLQVHDQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTR.. 435
54 -32.3003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  16  159.........YKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQGDNDVP------YTSIVALNEHASILHYMQCDTVAPKESRSFLIDAGANYHGYAADITRTYAQEGNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQIDTGMVNL-IGHFLGLQVHDKPAPDDHPFLRCTRMVEARQVFTIEPGLYFIDSLLRDLKATPASKYINWDTGIRIEDNIIVHRDKNENMTRD. 439
55 -32.0004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  17  159.........YKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDTP------FGNIVALNENCAILHYTHFDRVAPATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQTDFNIVNL-LGHHIGLQVHDQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTRE. 436
56 -32.0003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  11  172....SKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVTNAKLSDKIENKIDDVKFLKQLSPDLTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFIGSLIGLEFRDSNFILN--VKNDYRKIQRGDCFNISFGFNN------------KDSQSANNYALQLADTVQIPLDETEFLTN.. 437
57 -21.3004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  17  322.SLVQTAKATKNDHEMQGMRNSSAALVEFLCWLEKELLSGKRYTEIE--LADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPSGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLV---LKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFTGHGVGHYLHEGPIGIGHRSVPTGGELHASQVLTIEPGF------------------AKEKYGIRIENCYETVEAVVM...... 560
58 -19.2005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  20  347.SPVVKMKAVKNDVEIDNMKQAGLALLQFFHWCEQKRKTKELFNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIHYECTDKTATIKPAIYLLDSGGQYLHGTTDVTRTTHFGEPTAEEKRIYTLV---LKGHLRLRKVIFASYTNSSALDFIARENLFNNFMDYTGHGVGLTLHEGGC-----GPVGGAPLKKNMVLSNEPGY------------------MKDKFGVRIENMQYVISK......... 579
59 -19.0003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  21  313.TPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEIAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPERTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYV---LKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYTGHGVGSFLHEGPCGISY-KTFSDEPLEAGMIVTDEPGY------------------EDGAFGIRIENVVLVVPVKTK...... 548

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;