current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1qe0_A mol:protein length:420 Histidine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKKLast
1 -138.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model  100  1MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK 420
2 -126.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  39  6.IVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNL--LRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALG---SQGTVCAGGRYDGLVGQLKGKSVPAVGFAMGMERLLLLLEQVEQAE--IVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIE 428
3 -125.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  41  5.ARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGM-KVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIG---AQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQ 420
4 -121.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  38  12.IQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGL--LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLG---SQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRT 428
5 -113.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  40  26.LTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDANGENLTLRPENTAAVVRAAIEHNM--LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLG---AQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE-QEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLIN 450
6 -109.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  23  23.TEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGR--SLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEAVKELRQFFEQVEAYGYGVLFDASVVRGLAYYTGIVFEGFDRE----GKFRALCGGGRYDNLLTTYGSPPIPCAGFGFGDCVIVELLQEKRLLPDIPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL 446
7 -109.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  27  6.IEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEE---LLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRK---DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMSDPFSVFSIIDRYHKISREEFVDQRSAGIGEDGVSMIADLCSGTRGIDEMAR--ITGKSSEEIARMAAVEDLLASYGVKVRYDFSIVRGLSYYTGIVFEAYDRS----GQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIP-REKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLIS 423
8 -103.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  23  23.TEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARQLLAKG--RSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKIGLESNVVDAITSTLS-----LKTIDEIAQRIGEEAVRELRDFITQIEAYGFGVIFDASVVRGLAYYTGIVFEGFDRD----GNFRALCGGGRYDNLLTTYGSPTVPCVGFGFGDCVIVELLNEKKLLPELHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV 446
9 -101.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  22  12.FSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGDTGSEARALKFDQTVPLAAYIARHL--NDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGDFVIRINNLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDGSVDDVLDKLKHLSQTLPELGVSELETVITGVRNLGVPFCIDLAIARGLNYYTGTVYETTLIGHE---ALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKR 462
10 -100.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  22  66VLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-----TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVADRIGDGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQAGVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEETTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKR 511
11 -98.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  22  13VLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-----TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQAGVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEEKTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKR 458
12 -88.7003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  21  9MFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV----GVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASS--LKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYRKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASVKFDLTLVLHMSYYTGVVFEGYGNRLG-----VPLCSGGRYDELLSKFHR-PAQATGFGVRIDLLVEALNGEII----SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA.......................... 400
13 -78.0001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  23  16.YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD----STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSSAAN-----QPILSGGRYDQLLSNFQE-EAFAIGFCCHMDTILKALERQELEEDND............................................................................................. 338
14 -77.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  22  22FADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS---RDWIRLFDGGGDAVALRPEMTPSIARMAAPR--VAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRENLLTWSPAERDAAKRSREASDRELEALLRDAWRYLCRLAEALHDSGLAVTFDLALHRELDYYTGLVFEMFAPGVG-----APIAQGGRYDELLAQFGA-GAPAVGFAFEVERVMAVLEAQEEGEGE.............................................................................................. 372
15 -74.4006FTT Entity 1(prereleased)  ali follow..  16  4....PDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG----DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYINSET-----QPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV.................................... 388
16 -74.4005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  16  4....PDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG----DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYINSET-----QPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV.................................... 388
17 -60.1001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  16  2.........DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP-------------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSP----DSQIKVWYADFVYRYSGSD---LVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVR-----EDLLSASSFLQEKTVSVEIDLTLARTIEEYCGLIFTIYDTSSS-----RLVAAGGEYTVNGE-------KGVGGSIFLEGK........................................................................................................... 273
18 -48.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  38LSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLAPNLANYLRKLD--RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKKNIKRAARSESYYNGISTN........................................................................................................................................................................................... 267
19 -48.0002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  21  3..................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIELGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKR 161
20 -44.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  52LSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLTPNLYNYLRKLD--RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID-KPWIGAGFGLERLLKVKHDFKNI---------KRAARSESYYNGISTNL........................................................................................................................................................................... 282
21 -40.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  38LSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMLAPNLYNYLRKLD--RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDF-KIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKERLLKVKHDFKNIKRAARS......................................................................................................................................................................................................... 257
22 -40.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  57..RRKKDLQQIYAEERNYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIFRVDKNFCLRPMLAPNLGNYLRKL--DRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGA-----------FGLERLLKVKHDFKNIKRAARSESYYNGISTNL........................................................................................................................................................................... 285
23 -36.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  55LSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIFRVDKNFCLRPMLAPNLYNYLRKLD--RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSC............................................................................................................................................................................................................................................................... 212
24 -34.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  37LSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMVAPNIFNYARKL--DRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGIDFKIVG.................................................................................................................................................................................................................................................................. 191
25 -31.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  55LSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLYNYLRKLD--RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDS------------------------------------------------------------------------------------------------------CMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK................................................................................................... 266
26 -29.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  13  81............VKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGED----HPLFSQVFWLDGKKCLRPMLAPNLYTLWRE--LERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMK................................................................................................................................................................................................................................................... 239
27 -29.6002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  16  46LRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRES--GRYDAYGPEMLRIADRHKRELLYGP-TNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGLKAIPMRAET-GPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNT-----------RGIEV--GQIFYF----------------GTKYSDSMKA-DGTDAPIH-YGVGVSRLLGAIIEACIWPEAVAPFRVTILNLKAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT. 452
28 -26.5002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  15  32IRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKES--GRYETYGPNLYRLKDRNDRDYILGPTHEETFT-ELIRDEINSYKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLEFRAIIGDG-GAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDGTRYSDVLDENGREKSVIMGYGIGVSRLLSAIVEQNNWPTGIAPFDLHVVQMNEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSI 563
29 -24.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  11  57.YHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE--KTHVADFAPEVAWVTRSGEPIAIRPTSETVMYPAY-AKWVQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFE----------------IVFEDPKIPGEKQFAYQN------SWGLTTRTI-------GVMTMVHGDNMGL---------------------------------------------VLPPRVACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQA 420
30 -24.3005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  29..YDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDH--EGFSPEVAWVTHYGDSPIAIRPTSETIMYPAY-AKWIRSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIE----------------FEDEEGHKRLVHQTS-----------------------------------------------------------------WGCTTRSLGVMIMTHGVIPPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRID-SNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLE 385
31 -24.2005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  15  34IRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQES--GRWEQYGPELLRLKDRHEREFCVGPTHEEVIT-DLARNELNSYKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDFRPVQADN-GSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRG-DLPLPEVADLRNVVEGDPSPDGK---GTKYSEVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNLWPSALAPFQIALVPLKESVKQATDKLYAELTAAGFEVLLD-KKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITE 569
32 -24.1004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  12  33..YDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNH--EGFSPEVAWVTKYGDSEIAIRPTSETIMYSVF-PKWIRSYRDLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAVKLILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHY-------------------------------------------------------------LGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVL---------------PPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYD-ASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQ 389
33 -23.9001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  10  24IYGGLQGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS-PRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPYQQPPES-------------SAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG------------KWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI-----------------LVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRE 438
34 -23.9004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  42..HDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE-KTHVADFAPEVAWVTRSGAEPIAIRPTSETVMYPAY-AKWVQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKT-----------------------------------------------------------EKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVL---------------PPRVACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQA 404
35 -23.7005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  32....ISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDH--EGFKPEVAWVTHYGDSELAIRPTSETIMYPAY-AKWIRSHRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVIKGEKSENE-----------------------------------------------------------KFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNF--SRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVL---------------PPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVD-TNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPA 386
36 -23.4001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  16  25..YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMM-KLWVKVHTDLPIKIYQIVNTFRYEKHTRPLIRLMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPYLISKRPE---------------------------------------------------------------WDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLIL---------------PPIVAPIQVVIVPLIFKGKEDIVKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEK 377
37 -23.2001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  15  52..YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIH--KGFEDEVYWVTSKLQRKLALRPTSETVMYPMF-ALWVRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIP---------------------------------------------------------YLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHN------LGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCL---------------PPDVAAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRE 404
38 -22.9005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  39....ISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDH--EGFSPEVAWVTKSGKSDIAIRPTSETIMYPYF-AKWIRSHRDLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEAL-EMVDIILNEYASIYEDLLATPV----VKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSK-----------------------------------------------------MFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVL---------------PPKVAPVQVIIIPIIEEQKKICNEVECILKKAGVRVKID-SNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPK 393
39 -22.8003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  12  36..YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDH--KGFEAECFWVEQPLEERLALRPTSETAIYSMF-SKWVRSYKDLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRV--------------------------------------------------------------LQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVL---------------PPLIAPIHVVIIPIGCGKKNNQESADTLKSKLGLRVSID-FSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSH 398
40 -22.8004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  16  22.....PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTTSSE-NREYCIKP-MNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTR----------------------------------------PEKRIGSDEMWDRAE--------------ADLAVALEENNIPFEYQLG------FYGPKIEFTLYDCLDRAWQCGTV----RLSSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQ 391
41 -22.3001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  19  261.....AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS-GHWDHYQEDMFPPMQLDETESMVLRPMNCPHHMMIY-ANKPHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYSFRLS-------------------------------YRDPEDKEKYFDDDDMWNKA--------------------NMLKEAADELGLSYEEAIG-----AFYGPKLDVQVKTAMGKEETLSTA----RFDTYIGQDGEHHRPVVGVVSTMERFVAFLTEEGAFPTWLAPKQVQIIPVNVDLHDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVD 637
42 -22.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  31..GPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEH--EGFSPELAVVTHAGEEPLAVRPTSETVIGYMW-SKWIRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKA--------------------------------------------------------------LQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVL---------------PPRLAPIQVVIVPIYERVLEAAQGLRQALLAQGLRVHLD-DQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPG 383
43 -22.0004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  27......GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKP-MNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGP-------------------------------------------KIDIQIKDAIGR-LDFQLPIRFNLTYVSHDGDDKKRPVI---------AILG-----------SVERMIAILTENGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQ 396
44 -21.8005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  30..YDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDH--EGFAPEVAWVTRAGDTEVAVRP-TSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFD-----------------------------------------------------------IRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVM---------------PPRVASTQVIIIPVGQELLASCWRLESELCEGGVRARCD-DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVA 392
45 -21.6004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  23......GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKP-MNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNL-KFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGP-------------------------------------------KIDIQIKDAIGR-LDFQLPIRFNLTYVSHDGDDKKRPVI---------AILG-----------SVERMIAILTENGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQ 392
46 -21.2003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  39.....AGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVS-----EFYRNNMYLFDIE-GHEFAVKPMNCPYHILLFLNAKHRSKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDYDVFEEMKLVLERLFKLTFKVRLSMSDKSLIGKEFMGSKEEWEGAE-------------------------------------------------EALREAASRINEKYGIDIVELEGLDFIMMVEESGVSKEWQMGTIQFDFNLPRRFR-VVREEFGIEEVYIALLGSIERFLGVYLEHGRMPFTLAPIQFAVIAVKTGGEDLASSIAKGLLDKGFRVAVKGSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAAD 437
47 -20.2001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  16  258..EEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT-----DNYKDAMFTT-SSENREYCIKPMNCPGHVQIF-NQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTR----------------------------------------PEKRIGSDEMWDRAE--------------ADLAVALEENNIPFEYQLG------FYGPKIEFTLYDCLDRAWQCGTV----RLSSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQ 630
48 -19.9001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  11  123............ENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPP--RYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPYQQPPES-------------SAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG------------KWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI-----------------LVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRE 501
49 -19.1003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  13  45..PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS--GHWENYADDMFKVEDEEKEEYGLKP-MNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVKGGSGAESNY--------------------------FINFSTRPDHFIGDLKVWNHA--------------------QVLKEILEESGKPWKLNPG------FYGPKLDIMVTDHLRKTHQVATI----RFDKFKDQDNSYKRPIMATFGSIERFMALLIDSGRWPFWLNPYQAVIIPVNTKNVQQLDMCPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIE 448
50 -16.6001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  17  4....................................................................................................................................................................................................................................................................................................................................GSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVAR 103
51 -15.7002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  10  86IYGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSVDKFADFMESVLAQLDNYGQQELALRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFIGRIYLYLTKVGISPDKLRFRQH--MENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQD 654
52 -13.8002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  12  77.....GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGK--------------------------------ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIK 460
53 -13.6005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  14  94.....GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNK-----------------------------LYYNFPWGKELIETLWNLGDH---ELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIK 477
54 -13.5004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  12  71......CHPGFGPLGVELRKNLAAE-EQVFPVDALHHKPGPLLPSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGK--------------------------------ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIK 453
55 -13.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  12  1.MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGL-------------KIFVLSPNIRLESRQKDDGREFTQLDFEVERAK------DIMRLIERLVYGLKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDVDGFWRNYDLILPYGYGEVASGGEREWYEKIVAKIRKAGLN-------EDSFRPYLEIA---------------------KA--------GKLKPSAGAGIGVERLVRFI....................................................................................................... 272
56 -13.0003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  12  1.MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGL-------------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGLKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKLPYGYGEVSS--GGEREWEYEKIVAKIRAAGLK-------EDSFRPYLEIA---------------------RA--------GKLKPSAGAGIGVERLVRFI....................................................................................................... 272
57 -13.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  15.............PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAG----------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPFIYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDNLLDALAAGLPDCSGVALGVDRLVMLALGAE................................................................................................... 313
58 -13.0003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  15  108...................................KNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGN-----------------KLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRK---------------NVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIK 445
59 -12.9001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  14  56.........RFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIRLENLLKTSGKLRATLLHGALEHYVNCLDLVNRKLPFGLAQIGVCFHPVSNSNQRVGEKTEASLVWFTPTRTSSQDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSK-----------------------------LYYSFPWGKEPIETLWNLGDQ---ELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKSLQRKVL-------------------KLHPCLAPIKVALDVGKGPT-------VELRQVCQGLLNELLENGISVWPGYVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVK 435
60 -12.6003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  11  28.............PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAG----------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGFVYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDNLIEALKVGMPDCSGVALGVDRLVMLALGAE................................................................................................... 326
61 -12.2001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14  125...............LKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY---------LAQSPQLYKQIMVGVFE-----------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIAD-----DLMRLEEALLAEM-IRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEED-----GTTRSFDL-------LFRGLEITSGGQRIHRYEELLESLKAKGM---EAFHGYLEVFKYGMPPHGGFAIGAERLTQKL....................................................................................................... 401
62 -11.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  156...............LQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY---------LTQSSQLYLESVIASLG-----------KSFCMLSSYRAEQSRTVRHAEYLHLEAELPFIS------DLLNHLEDLVCTV--------------IDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMK-HPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGA-DPYYWYTQQRKYGSCPHGGYGLGVERLVMWL....................................................................................................... 435
63 -11.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  13  137...............FKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF---------LAESPQL---YKEIMMASGLD-------RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIED-----EVMSFLERLVAHAELDILNFELEEPKLPFPRVSYDKALEILGDLGKEPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFD-----------EYRGVEISSGGQREHRHDILVEQIKEKGL---ESFEFYLKAFRYGMPPHGGFGLGAERLIKQM....................................................................................................... 417
64 -11.5001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  135...............MKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAY---------LSQSAQLYLEAAIFGLE-----------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPSYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDP--NDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWV....................................................................................................... 413
65 -11.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  12  181...............FRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY---------LAQSPQF---NKQQLIVADFE-------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEH-----EVLDTLSELFVFI-PKRFAHEIELVRKQYPVEEFKLPKDGKMVRLT------------KEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIR-NPKYSNSYDFFMR---EILSGAQRIHKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFY....................................................................................................... 469
66 -11.2001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  15  104...................TLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMGPLGEEVEGRLLLRTHTSPMQVRYMVAHT------PPFRIVVPGRVFRFEQTDATHEAVFHQ--LEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRF--------QPVY--------------------------------------------------------------------------------------FVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDYRGVTGFAFGLGVERLAML........................................................................................................ 325
67 -11.2001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  17  134...............IKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAF---------LAQSPQLYKELMAGVVE-----------RVFEVAPAWRAEESDTPFHAEFISMDVEMAFAD------DVMQLLEKILHNI--------------VKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKNPELSESFDLIYK----------------LEIVSGSTFEFFLKWFDYGMPPHAGFGMGLARLMVML....................................................................................................... 408
68 -11.1005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  164...............LKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF---------LTQSSQLYLETCLPALG-----------DVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLT------DLLNRLEDLVCDV-LKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCP-----------DSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAG-TPYYWYTDQRKYGTCPHGGYGLGLERFLTWI....................................................................................................... 445
69 -11.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  11  134...............LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF---------LTQSSQLYLETCIPTLG-----------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFIT------DLMEKIEELVCDT--AKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDL---LMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWL....................................................................................................... 416
70 -10.9005c53_B mol:protein length:903 Pol gamma B  ali model follow..  15  592.....................................................................PGDSAFRLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGN-----------------KLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRK---------------NVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIK 895
71 -10.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  11  210...............FRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY---------LAQSPQL---YKQMCICADFE-------KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYH-----EVMEEIADTMVQI-QERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEK---------LLGHLVKEKYDTDFYILDKYPLAVRPFYTMNPKQSNSYDMFMR----------------EEILSGAQIKAYIDSFRFGAPPHAGGGIGLERVTMLF....................................................................................................... 494
72 -10.7003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  180..........LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKT--AQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVVGIGELNNAAAKKYDLEAWFPFQQEYKE----------------------------LVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVHCLN----------------------------------------------------STLSATERTICCILENYQKEDGLVIPEVLRKYIPPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKN............................................ 476
73 -10.7003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  14  244...............FRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY---------LAQSPQL---YKQMAIMGDF--------KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVEN-----ECIDVMEKLFTFI-----------FDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIR-DPNYSNSYDVFVR----------------QEITSGAQLKDYIESFRFGSWPHAGCGIGLERITMLY....................................................................................................... 527
74 -10.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  230.....................VRSQFRQIFLEMGFTEMPTPARDQHDTFFLRDPAEALQLPMDYYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFT-PVKYFSIDRVFRNETLDATHLAEFHQ--IEGVVADHGLTLGHLMGVLREFFTKLGITQLRFK-----------------------------------------------------------------------------------------------AYNPYTEPSMEVFSYHQGLKKWVEVGNSGVFRPEMLLPMGPENVSVIAWGLSLERPTMIK....................................................................................................... 468
75 -10.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  43HSMGSDGVYARTALYESIVERLAALITSHRE-AGTEALRFPPVMSRAQLEKEINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPK--GGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLTFRVDYASD-----------------------------------------------------------------------------------FGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGGEPAHTGCVAFGMDRLAVAM....................................................................................................... 305

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.