current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1qxw_A mol:protein length:252 methionyl aminopeptidase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEELast
1 -117.0001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model  100  1MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKIEEE 252
2 -110.0003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  32  6IKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDV-AIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKP-SILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTISKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKK 256
3 -109.0001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  33  8IRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGET-DERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDP-QIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKEG.. 256
4 -109.0003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  30  2ITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAQIGYEGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGEST-PEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYGVVRDFVGHGIGPTIHESP-MIPHYGEAGKGLRLKEGMVITIEPMVNTGTWRMKMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTSQGEE 251
5 -108.0004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  34  3VTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKT-PEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEP-QVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE 253
6 -107.0001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  35  39PWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGL-VVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL... 285
7 -107.0003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  35  42PWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGL-VVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL... 288
8 -106.0004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  30  49IKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDS 298
9 -106.0004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  33  3ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNQHAVSACLGYHGYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP-TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD 254
10 -105.0002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  30  67IKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDS 316
11 -104.0004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  33  61DDSKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRP-DDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSP-TVCHYANNKSLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDWVDG 310
12 -103.0003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  33  26VEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTV-IPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRDRAFGIVDGYGGHGIGRSMHLDP-FLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP.. 280
13 -103.0004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  30  2ITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFLPLQIGVDGYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLGGPGGLADSCWAYAVGTPS-EEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEP-MVPNYGIAGRGLRLREGMVLTIEPMINTGDWEIDTMKTGWAHKTIDGGLSCQYEHQFVITKDGPVILTSQGEE 283
14 -98.1004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  30  128IKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAP-NVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDS 377
15 -96.2003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  30  95IYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNP-TVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTKRTQD 347
16 -68.7002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  31  2.......DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPA------FP--VNLSINEIAAHYTPDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVG----MEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRNGIVAQFEHTIIVEKDSVIVTQDMINK 299
17 -60.4003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  18  37ENFTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGERNNGI-GFP--AGMSMNSCAAHYTVQDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFK----ENLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYPIRPISDLHGHSISQFRIHGGISIPAV-NNRDTTRIKGDSFYAVETFATTGKGSIDDRPPCSHFVLNTGCKVAQFEHTVYLSEHGKEVLTRGDD. 357
18 -59.8001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  21  158LDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIV-KGGEATRMEEGEVYAIETFGSTGKGVVH--DDMECSHYIKGSYTAQFEHTILLRPTCKEVVSRGDD. 477
19 -59.7005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  21  52LDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIV-KGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHLCDIKGSYTAQFEHTILLRPTCKEVVSRGDD. 371
20 -58.6002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  22  3QTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKKEKEMKKGIAFPTSISVNNCVCHFSPQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITSGPFE 332
21 -56.2002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  22  11QTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKKGIAFPTSISVNNCVCHFSPQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITSGPFE 340
22 -54.4005fl8_u mol:protein length:380 ARX1  ali model follow..  18  3KNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEAIPSDDFVVQSGEVYLIDLKMASLEHKAGELIARPGAYVRDSTLVARECNTIVLCDSSVSTTDRPE.. 343
23 -53.2004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  17  12NVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSYRDKKTNKGFSHPTTVSPAAFITPYTPLATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDPRQADLFLATYYANEVLLRLMVPPGLLAKISSLLEKVAKAYDCNIIESTTSWLFDKNEIEGKKKIILSPNIKGEGVPEVGDVWGVEVGCSLGSGKVKQFEQRATLHRRTNAPVCRLLTTIAITKNGITRIGGPPA. 358
24 -49.1005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  15  35.NILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMETVVALLASGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAE-REYKGVVWTESHQEADLLSNTDAKDLTVVQSTPFTNVSAIPSDDFVVQSGEVYLID........... 337
25 -48.7004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  13  33.NILQESVLNKYRTAGQIAQTALKYVTSLIQRQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPILACALTPEKLPASLGGTSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAE-REYKGVVWTESHQEADLLSNTDAKDLT-VVDRGQSTPFTNVSAIPSDDFVVQSGEVYLIDLKMASLE 342
26 -45.3005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  30  125.AVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESA------FELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEM-KRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGAFAHSLGHGVGLEVHEGPGL-----RGTSQDVLEAGMVITIEPGAYL-----------------PGVGGVRIEDLILVTEDGYEVLSHSAKE 347
27 -45.2001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  29  123.IIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKP-----AFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVVGSPNEKQ-REIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGYFIHSLGHGVGLEIHEWPRI-----SQYDETVLKEGMVITIEPGIYI-----------------PKLGGVRIEDTVLITENGAKRLTKTERE 346
28 -44.9001wn1_A mol:protein length:356 dipeptidase  ali model follow..  27  130.MIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIA------FEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERL-VKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGYFIHRTGHGLGLDVHEEP-----YIGPDGEVILKNGMTFTIEPGIYV-----------------PGLGGVRIEDDIVVDEGKGRRLTKAERE 352
29 -44.9001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  29  126.IIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKP-----AFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVVGSPNEKQ-KEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGYFNHSLGHGVGLEVHEWPRV-----SQYDETVLREGMVITIEPGIYI-----------------PKIGGVRIEDTILITKNGSKRLTKTERE 349
30 -44.5002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  25  132.MVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGV-----AFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSIGEPSDEV-KEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGFFGHSLGHGIGLEVHEGPAI-----SFRNDSPLPENVVFTVEPGIYL-----------------EGKFGIRIEEDVVLKEQGCEILTTLPRS 355
31 -44.3003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  27  129.LIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSS-----SFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGEPSDKL-KEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGYFGHSTGHGIGLEIHEAPGL-----AFRSDTVLEPGMAVTVEPGIYI-----------------PGIGGVRIEDDIIVTSEGNEVITKSPKE 352
32 -44.3001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  18  156.MIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTEDVELMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDHCSDDH-LRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLYRTFGYGHSFGTLSHYYGREAGLELREDIDTVLEPGMVVSMEPMI-------------MLPEGLPGAGGYREHDILIVNENGAENITKFPYG 394
33 -44.1004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  28  143.EIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDV----SFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEV-KKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGYFIHRTGHGLGIDVHEEP-----YISPGNKKILKDGMVFTIEPGIYL-----------------QGKFGVRIEDDVALVDKKGIRLTNADRE 367
34 -43.9005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  23  126.QIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKA-----SFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEGSHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGYFGHNTGHAIGIEVHEDPRF-----SPRDTTTLQPGMLLTVEPGIYL-----------------PGQGGVRIEDVVLVTPQGAEVLYAMPKT 354
35 -43.7004zng_C mol:protein length:362 Prolidase  ali model follow..  20  133.LIKSADEIEKMKVAGDFADKCFEIGTAAERNGVTESDIVAKIEYEMKRMGVPQM-----SFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFD-AEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGYFNHRLGHGIGMDVHEYP-----SIVAGNDLVIQEGMCFSNEPGIYI-----------------PGKVGVRIEDCLYVTENGCESFTHTDHD 358
36 -43.6004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  25  166.MCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNG-----STFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIYGTPSDAQ-QRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGGLPHRTGHGCGLAIHEAP-----YLVRGNRQPLQPGMCASNEPMIVV-----------------PGAFGVRLEDHFYVTDTGAQWFTPPSVA 394
37 -43.5001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  18  156.VIKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXPYVELMDTWIWFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFLXXVXDAS-LXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFYGHSFGVLXHYYGREAGVELREDIXTVLEPGMVVSMEPMV-------------MXPEGEPGAGGYREHDILVIKENXTENITGFPFG 394
38 -40.4004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  25  149.MVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAFVI------VGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGDPSPDV-AQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAYFVHRTGHGIGLCVHEEP-----YIVAGNELPLVAGMAFSIEPGIYF-----------------PGRWGARIEDIVVVTENGALSVNNRPHE 372
39 -38.1004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  15  205.AIKGPDEILAMRCASHACETAVAEMEKFARAHVGDDDIWAVLHAENIKRGGEWI------ETRLLASGPRTNPWFQECGPRITQKNEIIAFDTDLISYGICVDISRTWWIGDQKPRPDMYAMQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDDKFQAQKYGCL-MHGVGLC-DEWPLVAYP--PGSYDYPLEPGMVLCVEAAVGE----------------VGGDFSIKLEDQVLITEDGYENLTTYPFD 440
40 -37.7005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  19  146.LVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAAGMQAG------HDVNVSFGVNAADSHYEPSEQTLHPGECVLIDLWAQEPGRFADVTWVGFAGEPGTEY-LDAWQAVRAAREAALELLRSRFVAEELDRAARDAMGERWAPHFLHRTGHDLGVQIHGAGANLDDY-ETRDTRTLTPGLSVTVEPGTYPAA----------ASPSGQGGFGIRSEVDVYLAPDGPEVTTDLQQA 396
41 -37.0004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  16  222.SVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEWIETRL------LASGPRSNPWFQECGPRVCQRNEIISFDTDLVAYGICTDISRSWWIGDQKPRADMYAMQHGVEHIRTNMEMLKPGVMIPELSA--NTHVLDAKFQ---GCLMHGVGLC-DEWPLVAYP--AGAYDYPLEPGMTLCVEALISE----------------EGGDFSIKLEDQVLITEDGYENLTKYPFD 457
42 -36.0004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  21  173..FKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGAR-----YPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGELGILKG-LSHWLGMDVHD----VGDYGSSDRGRILEPGMVLTVEPGL--------YIAPDADVPPQYRGIGIRIEDDIVITATGNENLTA.... 420
43 -36.0005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  18  175..YKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKGGAK-----MPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPANGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGRLGLLEG-AGHWLGMDVHD----VGEYRVGGEWRVLEPGMAMTVEP--------IYIAPDNTTVAKKWRGIGVRIEDDVVVTRNGCEVLTN.... 423
44 -35.6005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  16  172IAVKEDGELNLMKKAASITSEVFNKFDEKVRHSKLAESVEKAIEEKKYLAGADPSTVEM-CYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVD--PSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKILGFGMGIEFREGSLVI----NSKNQYKLKKGMVFSINLGF-------SDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLT.... 419
45 -35.1005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  19  196.AAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKILHSTLMEETEKVILDPAK-CYPPIFQSGGKFDLRPSAVSNDYYDSASVIICAVGARYKSYCSNIARTFLID--ADPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDAPDMVSCLAGTGIGIEFRESGLNI----NAKNDQIVKEGMVFNVSLGFQN--------LHCENSKSKNKVFSLLLADTIIINKDKTDVVTSIGSK 449
46 -35.0005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  18  195..IKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGAD-----ILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMKNIKENNAFKAARKYCPHHVG---HYLGMDVHDTPDMPRSLPLQPGMVITIEP--------IYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSA.... 439
47 -34.8001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  20  175..FKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGAR-----YPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGKLGILKG-LSHWLGLDVHDVGVY-----GQDRSRILEPGMVLTVEPGL--------YIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTA.... 421
48 -34.8003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  23  171..FKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIK-----HHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGAVGLIQE-VSHFLGLDTHDVGTY--------KDRVLEEGMVITIEP-----------------LYIEEESIGIRIEDDILVTKDGHENLSK.... 399
49 -34.8003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  15  175LAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNEAFFQTKSLKLGYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFD--PDSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKRPDLEPNFLGAGIGIEFRESSLLV----NAKNPRVLQAGMTLNLSI--------FGNLINPHPKNSQSKEYALLLIDTIQITRSDPIVFTDSPKA 433
50 -34.7002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  19  186.VFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHS----SYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEEHMGILSG-LGHFLGIDVHDERIDEPGLRSLRTARHLQPGMVLTVEPGIALADPARASFFNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRT 472
51 -33.6006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  13  174WAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKSRFLKKLS---AYSPIIQSGPKYDLRVSASSETQLDGNGCILASCGIRYKNYCSNISRTFLID--PSDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSKKPELSAGFVGSLMGLEFRDSQFVL---NNKNDYRKVENGDCFNISLGFNNLKDS-----------KTGASYALQLADTVQLTSGGPKVLTNYTKS 437
52 -31.9003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  17  158.AYKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQGDNDVP------YTSIVALNEHASILH--CDTVAPKESRSFLIDAGANYHGYAADITRTYAQGVHNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQIDTGMVNL-IGHFLGLQVHDPKPAPDDHPFLRCTRMVEARQVFTIEPGLYFIDSLLRDLKATPASKYINWDTGIRIEDNIIVHRDKNENMTR.... 438
53 -31.8003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  11  175WEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVTNAKLSDKIENKIDDVKFLKQLSPDLTYSPIIQSGKKFDLVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANDFLLTLQKEIV---TNILKPGRTPKEVYESVIEYIEKTKPELVPNFIGSLIGLEFRDSNFIL---NVKNDYRKIQRGDCFNISFGFNN------------KDSQSANNYALQLADTVQIPLDETEFLTNYTKA 441
54 -31.5004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  19  160.SFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVP------YSNIVALNEHAAVLH---DHQAPEEMRSFLLDAGAEYNGYAADLTRTWS-AKSDNDY-AQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLKHQIITD-IGHPLGLQVHDHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKHFNWQKGIRIEDNVVIHENNVENMTR.... 438
55 -31.3003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  17  158.AYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDNP------YGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFT--GEGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCHQRVAQTDFNIVDL-LGHHIGLQVHDHQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTR.... 435
56 -30.6004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  17  158.AYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDTP------FGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFT--GEGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQTDFNIVNL-LGHHIGLQVHDHQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTR.... 435
57 -21.5004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  15  329.ATKNDHEMQGMRNSSAALVEFLCWLEKELLSGKRYTEIE--LADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHG-TGHGVGHYLHEGPIGI-GHRSVPTGGELHASQVLTIEP------------------FYAKEKYGIRIENCYETVEAVVM........ 560
58 -20.6005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  18  354.AVKNDVEIDNMKQAGLALLQFFHWCEQKRKTKELFNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIHYECTDKATIKPAIYLLDSGGQYLHGTTDVTRTTHFGEPTAEEKRIYTLVLKGHLRLRKVIFASYTN----SSALDFIARENLFNNFMDYTGHGVGLTLHEGGCSI----GPVGGAPLKKNMVLSNEP------------------YYMKDKFGVRIENMQYVISKSFDDLTMYPYE 599
59 -20.3003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  20  320.AVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEIAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHG-TGHGVGSFLHEGPCGISY--KTFSDEPLEAGMIVTDEP------------------YYEDGAFGIRIENVVLVVPVKTK........ 548

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;