current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1qzg_A mol:protein length:187 Protection of telomeres protein 1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst GPGGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKNGELLSTSLast
1 -86.3001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model  100  1GPGGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKNGELLSTS 187
2 -56.6001jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  15  8NRSTSRVSKKKTAAPKEGAAKKSDKGHKYEYVELAKASLTSAQPQHFYAVVIDATFPYKTN--QERYICSLKIVDPTLYLKSDYATLVLYAKRFEDLPIIHRAGDIIRVHRATLRLYNGQRQFNANYSSSWALFSTDKRSVSDTTPFSFSSKHATIEKNEISILQNLRKWANQYFSSYSVIS..... 207
3 -51.0006bwy_A mol:protein length:361 Protection of telomeres protein 1, DNA dC->dU-editing enzyme APOBEC-3G fusion  ali model follow..  93  3.......IDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNHSMDPPTFTFN 182
4 -50.0003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  21  2.....................SLVPATNYIYTPLNQL--KGGTIVNVYGVVKFFKPPYLSK--GTDYCSVVTIVDQT----NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLG---APIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLC.. 154
5 -18.4001jmc_A mol:protein length:246 PROTEIN (REPLICATION PROTEIN A (RPA))  ali model follow..  12  118......................HLPTVQFDFTGIDDLENSKDSLVDIIGICKSYEDATKRSNNREVAKRNIYLMDTS----GKVVTATLWGEDADKFDG--SRQPVLAIKGARVSDFGGRSLSVLSSSTIIA-------------------------NPDIPEAYKLRGWFDAEGQA.......... 245
6 -17.6001fgu_A mol:protein length:252 REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT  ali model follow..  11  114......................HLPTVQFDFTGIDDLENKSDSLVDIIGICKSYEDATKRSNNREVAKRNIYLMDTS----GKVVTATLWGEDADKFDG--SRQPVLAIKGARVSDFGGRSLSVLSSSTIIA-------------------------NPDIPEAYKLRGWFDAEGQALDGVSISDLK 251
7 -15.9006d6v_D mol:protein length:701 Telomerase-associated protein 82  ali model follow..  10  331..GNDSIGDSDYSIHNLIEKEESIAQKGYNGQKNNKYRQNNNNISEVLKTSKQYLSVLADIQSSDKNIRLKICDNSC----NQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKE------------------------SDDQRKVITYNQEQGVFKKSISINSNDSFE 496
8 -15.8002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  15  2.............................DLVKIRDVSLSTPY-VSVIGKITGIHKKEYESDGTTKSVYQGYIEDDT------RIRISSFGKQ-------LQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVN.................................................. 96
9 -15.7002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  12  2.........................KPEHRMDTISKL--EEGAETPVTGRVMKISSPRTTRKGREGKLANVIIADDT------ELRAVFWTENIKLLKKF-REGDVIRIKDVNIRGFGGRKEAHLMPRSTVEVLDPLE................................................. 109
10 -15.6003dm3_A mol:protein length:105 Replication factor A  ali model follow..  10  12.......................................SPGMTATFEGEVISALPIKERADGSIGKLKSFIVRDET------SIRVTLWDNLTDI----VGRGDYVRVRGYIREGYYGGLECTANYVEI......................................................... 96
11 -15.3001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  13  3...............................EKVGNLKPNMES-VNVTVRVLEASEARQQTKNGVRTISEAIVGDET------RVKLTLWGKHAGSI----KEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDG................................................. 100
12 -15.1005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  15  3.............................TETFVKDIKPGLKN-LNLIFIVLETGRVTKTKDGHE--VRTCKVADKT------SINISVWDDVGNLI----QPGDIIRMTKGYASVFKGCLTLYTGRGGDLQKIGEFC................................................. 99
13 -15.1002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  12  3...............................EKVGNLKPNMES-VNVTVRVLEASEARQQTKNGVRTISEAIVGDET------RVKLTLWGKHAGSI----KEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQIP......................................... 108
14 -14.7001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  2................SSGSSGSTVKRKPVFVKVEQLKPGTTG-HTLTVKVIEANIVVPSRPSQPSRIVECLIGDET------CILFTARNDQVDLM----KPGATVILRNSRIDMFKGTMRLGVDKWGR......................................................... 116
15 -13.6004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  16  3.............................TETFVKDIKPGLKN-LNLIFIVLETGRVTKTKDGHE--VRTCKVADKT------SINISVWDDVGNLI----QPGDIIRLTKGYASVFKGCLTLYTGRGGD......................................................... 91
16 -12.6002kbn_A mol:protein length:109 Conserved protein  ali model follow..  14  4.............................QLTKIVDIVENGQW-ANLKAKVIQLWENTHESI-----SQVGLLGDET------IIKFTIWKNAEL---PLLEQGESYLLRSVVVGEYNDRFQVQVNKNSSIEKLSEP.................................................. 97
17 -12.6004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  10  109..................TDATDVPEVKYEFVRINELESEANQQCDVIGILDSYGELSEKASQRPVQKRELTLVDQG----NRSVKLTLWGKTAETFPTNAGVDEVLAFKGVKVGDFGGRSLSMFSSSTMLI-------------------------NPDITESHVLRGWYDNDGAHAQFQPYTNGG 254
18 -12.6002k5v_A mol:protein length:104 Replication protein A  ali model follow..  11  1...............................MNYKISELMPNLSGTINAEVVAAYPKKERKDGTKGQLKSLFLKDDT------SIRGTLWNELADFE---VKKGDIAEVSG-YVKQGYSGLEISVDNIGI......................................................... 92
19 -12.3003e0e_A mol:protein length:97 Replication protein A  ali model follow..  13  9.......................................MPNLSGTINAEVVTAYPKKERKDGTKGQLKSLFLKDDT------SIRGTLWNELADF---EVKKGDIAEVSG-YVKQGYSGLEISVDNIGI......................................................... 92
20 -12.0004hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  12.......................................TPHQRCSFYAQVIKTWY--------SDKNFTLYVTDYTENEGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLG................................................................... 102
21 -11.8004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  12  72.....TSSSVVVDVESNHEVPNNVVKRARETPRISKLKIPCGTIVNGLFKVQKITEEKDRV--------LYGIHDKT------TMEVLVLGNPSKT----CEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVIKAAKPKT.............................................. 192
22 -11.8002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  13  117..................................IDILHKQASGNIVYGVFMLHKKTVNQK------TTIYEIQDDR------KMDVVGTGQCHNI----CEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTN................................................. 206
23 -11.0003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  17  118.....................................TQPLGTIVNGLFVVQKVTEKKKNI--------LFDLSDNT------KMEVLGVRNEDTM----CKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKTAAAS........................................... 208
24 -10.9003kf8_A mol:protein length:220 Protein stn1  ali model follow..  14  86..........................................NQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTDKKNYGKIVELEG-EIYNWYDSINVSKKPDRELKV...................................................... 176
25 -9.9804l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  85....HEYSSVSEVKSQNKEDSSSSDERPIEHLKICDLHLTEERLVDGEFKVYRKSSGNNCI--------CYGIWDDT------AMKVVVSGQLTSV----CEIGNTIRLVCFELTSNADEWFLRATRYSYMEVIMPEK................................................. 203
26 -9.3804jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  17  119.....................................ELDSGTLIYGVFAVEKKKVNDKS--------ITFKIKDNE------NIKVVWDKEQHNI----YEKGDKLQLFSFHLRKGNGKPILHSGNHS.......................................................... 194
27 -9.0304lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  15  115.....................................ELDSGTLIYGVFAVEKKKVNDKS--------ITFKIKDNE------NIKVVWDKEQHNI----YEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGEK.................................................... 196
28 -9.0101ynx_A mol:protein length:114 Replication factor-A protein 1  ali model follow..  13  4...............................IFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDT----SGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHP............................................................ 95

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.