current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MVDLKRLRQEPEVFHRAIREKGVALDLEALLALDREVQELKKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALREKEARLEALLLQVPLPPWPGAPVGGEEANREIKRVGGPPEFSFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGKEVLEPCGLast
1 -134.0001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model  100  1MVDLKRLRQEPEVFHRAIREKGVALDLEALLALDREVQELKKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALREKEARLEALLLQVPLPPWPGAPVGGEEANREIKRVGGPPEFSFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGKEVLEPCG 421
2 -125.0002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  36  1MIDINLIREKPDYVKERLATRDKELVVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLEGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHP--DTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE. 425
3 -121.0003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  75  110..QIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEIVNRASLAAGPMVKIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKLEALLLQVPLPPWPGAPVGGEEANREIKRVGGPPFSFPPLDHVALMEKNGWWE-PRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGKEVLEPGA 530
4 -120.0002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  37  1MLDIKLIRENPELVKNDLIKRGELEKVDEILKLDTEWRTKLKEINRLRHERNKIAVEIGKRKGEPVDELLAKSREIVKRIGELENEVEELKKKIDYYLWRLPNITHPSVPVGKDENDNVPIRFWGEILEWKPKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKDTKGIFRVHQFHKVEQFVYSRP--EESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVLWKYTGFKEIVPV. 446
5 -119.0003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  27  2VLDLDLFRVDPALIRETQEKRFKDPGVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKKVEFVHMLNATMCATTRTICAILENYQTEKG-ITVPEKLKEFMPPGLQE... 466
6 -115.0001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  31  34LLDMESLCAYPEDAARALDLRKGELDLPGIISTWQELRQLREQIRSLEEEKEAVTEAVRALVVNQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHPDVPVGDESQARVLHVVGDKPFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETD-TGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPPALQPYLGTDRITTP. 470
7 -113.0006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  28  3MLDINLFRENPEIIRESQRRRFADVTVDKVIELDEVWRATIGKLNHIKSFTGIISKEVGNRMKNTNQLKKLSTYITEVHIKNSEEEVKQKEKERDDVLLQIGNIVHETVVVSDNEDNNGIVRMVGPETGYKCLKHIDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVEGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVGAHGKDTLGIFRVHQFEKIEQFVVTSPKDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAWFPGGNEYRELVSCSNCTDYQTRRLEVKYGKQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPEG-VNVPEVLQPYMGGTKFIKF. 477
8 -113.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  29  1MLDINAFLVDPEIIKASQKKRGDSVEVDEIIAEYKEWVKLRFDLDEHNKKLNSVQKEIGKRAKEDAKDLIAEKEKLSNEKKEIIEKEAEADKNLRSKINQVGNIVHESVVDSQDEENNELVRTWTPEGAPAKLSHHEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVGEDEKYLIATSEQPISAYHAGEWFESEQLPVRYAGYSSCFRREAGSHGKDAWGIFRVHAFEKIEQFVLTEP--EKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGQNQQEKKYVHCLNSTLSATERTICCILENYQKEDG-LVIPEVLRKYIPGEPEFIP. 443
9 -112.0003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  25  7VLDIQLFRDEANIIRESQRRRFADPDVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKELQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRVKEYCHMLNGTLCAITRTMCCICENYQTEEG-VVIPDVLRPYMMGIEMIRF. 469
10 -59.4003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  15  25TVEEFVKEANEDLLQRGVPTGKEGAKIYDTIYMEITGTRYLRPHEAAMRVRKRLAERLGRKHRYDYVGYVPVADDVVVEDGTVRLTFQDVDEERRHVIDRVIRLVAWAVEERSELVERVTKVEPGTDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVTRKGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVRDPGYVLAPAQCEPFYELLRDEVVDPERLPIKYDCSGWTYRWEGGA----AKGLERVNEFQRIEHVWIAEP--EEAYRIRRELLEATKRVAEELELEWKVVLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEHFVDGNVKEKSGRTLFTGCAGLGVTRWVVGLLAQHGFYPYEEPILERIDEKFGGLPEVPK. 521
11 -45.6004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  12  1....................................................................................................MGSSSSGLVPRGSHMNIAVLPN--------SPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAAL-ITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRRE------PSKHLDRLQSFRMREYVCIGTP--DDVSDFRERWMVRAQAIARDLGLTFRVDYASLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG----EPAHT-GCVAFGMDRLAVAMFHTHG--TDLSAWPAKVRDILGLQPHVAAG 333
12 -44.9003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  12  1....................................................................................................MGSSSSGLVPRGSHMNIAVLPN--------SPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRRE------PSKHLDRLQSFRMREYVCIGTP--DDVSDFRERWMVRAQAIARDLGLTFRVDYASKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG----EPAHT-GCVAFGMDRLAVAMFHTHG--TDLSAWPAKVRDILGLQPHVAAG 333
13 -34.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  14  68..........................GEDRIELTLQSGRYVRVHDAIFRLRKQLAEALGKKYKIGIRGIEVESFIIKVPADHEVGEAEMKNRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAM------MKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEPGYREMIFPKLVTWEVWMKSGHAKGVYPEIYKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGG----IHGIERVDEFHRIEIVWIGTK--EEVLKCAEELHDRYMHIFNDILDIEWRKARVTGLAEENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWS-GCSGVGLERWAAVFLAQKGLDPAN---PEEFRNRVG........ 507
14 -24.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  14  37..............................................................................................................................KEENLADWYSQVITKSEMIEYHDI-----SGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWLAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAFA-TMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMG-LVLPPRVACV.......... 319
15 -23.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  16  49.........................................................................................................................................................EAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQ----RPRFGVMRGREFLMKDAYSFDVDE-AGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSH----EFIVLAETGESGVYIDRDVLIFYSDSMKANVTGPDGTDAPI-HGGSYGVGVSRLLGAIIEACHDDNG-IIWPEAVAPF.......... 360
16 -23.2004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  14  1............................................................................................................MGSGEGQGPKKQTRLG-KKEENLADWYSQVITKSEMIEYHDI-----SGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWLAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAFA-TMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMG-LVLPPRVACV.......... 303
17 -22.6005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  14  2................................................................................................................ASKENESLLGITADKITSFADWYSQVIVKSEMIEYYDI-----SGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLTEKDHVEGFSPEVAWVTAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEF----KHPTPFIRTREFLWQEGHTAHS-TRKEALEMVDIILNEYASIYEDLLATPVVKGTKSEEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQ--TSWGLTTRAIGVMIMTHGDNKG-LVLPPKVAPV.......... 296
18 -22.6004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  13  11.............................................................................................................................KKIENFSDWYTQVIVKSELIEYYDI-----SGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLKEKNHIEGFSPEVAWVTPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEF----KQPTPFIRTREFLWQEGHTAHK-NEEEAVKLVFDILDLYRRWYEEYLAVPIIKIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQ--TSWGCTTRSIGIMIMTHGDDKG-LVLPPNVSKY.......... 292
19 -22.5005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  17......................................................................................................................................YIDVITKAEMIEYY-----DVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLREKDHIEGFAPEVAWVTEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEF----SHPTPFIRTREFLWQEGHCAWAKA-EECAKEVLEILECYASVYEQLLAVPVVRGRKTEEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRG-MVMPPRVAST.......... 291
20 -21.9001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  14  1............................................................................................................................GSHMLEFSEWYSDILEKAEIYDVRYPI----KGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYET----KHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTM-QIATVHNLGQNFSKTFEIIFETPTGDKDYAYQ--TCYGISDRVIASIIAIHGDEKG-LILPPIVAPI.......... 283
21 -21.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  2..................................................................................................................AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPV----KGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKESDHIKGFEAECFWVEEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHET----KNTKPLIRVREIHWNEAHCCHATA-EDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTC----ISTRVLACALSIHGDSGG-LVLPPLIAPI.......... 294
22 -21.4005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  15  8.............................................................................................................................KKSTNFADWYTQVIVRGELVEY---YDISG--CYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLKEKDHVEGFKPEVAWVTPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEF----KQPTPFLRTREFLWQEGHTAHA-TEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQ--TSWGCTTRSLGVMIMTHGDDKG-LVLPPRVVAV.......... 289
23 -20.9005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  15  28.......................................................................................................................................................YYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLKEKDHVEGFSPEVAWVTPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEF----KQPTPFLRTREFLWQEGHTAHA-TEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQ--TSWGCTTRSLGVMIMTHGDDKG-LVIPPRVASV.......... 288
24 -20.6001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  10..............................................................................................................................QSQDFSEWYLEVIQKAELADYG---PVRGT--IVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLKEAEHVEGFSPELAVVLEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEM-----RTRPFLRTSEFLWQEGHTAHA-TREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEEKFAGAVYTTTIEALMKDGKA--QAGTSHYLGENFARAFDIKFQDRDLQVKYVHT--TSWGLSWRFIGAIIMTHGDDRG-LVLPPRLAPI.......... 288
25 -19.5001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  16  29.............................................................................................................................EKMTEFSEWFHNILEEAEIIDQRY----PVKGMHVWMPHGFMIRKNTLKI-LRRILDRDHEEVLFPLLVPEDELKEAIHVKGFEDEVYWVLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKH---TRPLIRVREITTFKEAHTI---TASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKT--QIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTC----LSDRVIASVIAIHGDESG-LCLPPDVAAH.......... 309
26 -19.3002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  32......................................................................................................................................................IRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEK----RSRSGLLRGREFIMKDGYSF-HADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAIS---GEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQR....................... 276
27 -19.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2...............................................................................................................................GSSSSGDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAMEQIEDE--IKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG-----DIEVWDQAEKQLENSLNEFGEKDFQPIRFNLTYVSHDGDDKKRPVIVHRAISVERMIAILTENYGGK-----WPFWLSP........... 304
28 -19.0004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2...................................................................................................................................ARDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAMEQIEDE--IKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG-----DIEVWDQAEKQLENSLNEFGEKDFQPIRFNLTYVSHDGDDKKRPVIVHRAISVERMIAILTENYGGK-----WPFWLSP........... 300
29 -18.8005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  16  34......................................................................................................................................................IRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEI----RPRFGLMRGREFIMKDAYSF-HLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLA---GEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQ............................ 273
30 -18.5003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  16  4..................................................................................................................GQDKTHIDYAYELDITVKPDSRVPVFNREFATF------TGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLFDIEG--MNCPYHILLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSG---SIYGLLRVRGFTQDDAHIIVPGGRVIDVEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTIQFDFNPRRFRLYDVVREEFGIEEVYIIHRALSIERFLGVYLEHRRGR-----MPFTLAP........... 338
31 -18.2004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  2...................................................................................................................................ARDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGLMRVRGFTQDDAHIFCTEEQIRDE--VNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERKVPVMIHRAILSMERFIGILTEEFAGF-----FPTWLAP........... 300
32 -17.4001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  12  118..DFEQIEKTMQIVNENMKIERKVVSRDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNKMLQRIYGTAFFD--------KKELKAHLQMLEERKERDHRKIGKELELFTNSQLV---GAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASG---AVSGLQRVRGMTLNDSHIFVRP--DQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSDFLPERFDLTYIGQDGEHHRPVVIHRGVVTMERFVAFLTEETKGA-----FPTWLAP........... 545
33 -16.9003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  25................................................................................................................................ATPATMTSMVSQRQDLFMTDP----LSPGSMFFLPNGAKIFNKLIEFMKLQQFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMCLIFGKKDRSYNELPLRFSDFSPLHRNEASG---ALSGLTRLRKFHQDDGHIFCTPSQVKSE--IFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTR-DLKVWNHAEQVLKEILEESGKPDFQPERFDLKFKDQDNSYKRPIMIHRATFSIERFMALLIDSNEGR-----WPFWLNP........... 339
34 -15.9001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  224..................................................................................................................ADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGLMRVRGFTQDDAHIFCTEEQIRDE--VNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERKVPVMIHRAILSMERFIGILTEEFAGF-----FPTWLAP........... 539
35 -15.1001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  9.......................................................................................................................................VALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVRDDMEGLDASVLTHRLVLHYSGHEATFADPMVDGRGLLAYLRPTAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITP----RNFIFRVREFEQMEIEYFVRP--GEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFP---GSLELEGIAQRTDFDLGSQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTRE-VLKLKPQLAPI.......... 336
36 -14.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  48...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIV......................................................................................................... 191
37 -13.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  12  47...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFFQM------GSGCTRENLESIITDFLNHLGIDFKILELSSAVVGPIPLDRFGLERLLKVKHDFKNIKRARSESYYNGISTNL........................................................... 267
38 -13.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  65...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKI.......................................................................................................... 207
39 -13.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  13  48...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLAFAQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM----------HGDLELSSAVVGPIPLDREWGID-----------KPWIGAGFGLERLLKV............................... 244
40 -13.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  62...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTESKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLVFWQM------GSGCTRENLESIITDFLNHLGIDFKIV......................................................................................................... 205
41 -12.8001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  14  125....................................................................................................................................................................LHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPRYFNMMFQDLRGGRGLLAYLRPTAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPR----NFIFRVREFEQMEIEYFVRPGEDEYW--HRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFP---GSLELEGIAQRTDFDLGSQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTRE-VLKLKPQLAPI.......... 399
42 -12.6004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  13  65...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLSFIQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM----------HGDLELSSAVVGPIPLDREWGIDKP-------------GAGFGLERLLKV............................... 261
43 -12.3002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  65...............................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDT----------LDVMHGDLELSSAVVGPIPLDREWGIDKP-----------WIGAGFGLERLLKVKHDFKNIKR...................... 270
44 -11.6002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  78...............................................................................................................................................................LRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQ-------HLNEFTMLNLTELGTPLEERH----QRLEDMARWVLEAAGI---------REFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDP-------------GLGFGLERLLMIR-------EGTQHVQSMARSYLDGVRL.... 299

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.