current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1tuf_A mol:protein length:434 Diaminopimelate decarboxylase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst FLGNDTVEIKDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRWEEETGKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKVEMPNLILEPGRSLVATAGYLLGKVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKNEKEVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLIAKDIVPPHLLLast
1 -118.0001tuf_A mol:protein length:434 Diaminopimelate decarboxylase  ali model  100  1FLGNDTVEIKDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRWEEETGKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKVEMPNLILEPGRSLVATAGYLLGKVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKNEKEVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLIAKDIVPPHLL 434
2 -109.0002o0t_A mol:protein length:467 Diaminopimelate decarboxylase  ali model follow..  30  13VWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAFGS-------GANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGETAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTALPTPKLVVEPGRAIAGPGTITLYEVGTVKDTAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEVRGVPR. 453
3 -109.0001hkv_A mol:protein length:453 DIAMINOPIMELATE DECARBOXYLASE  ali model follow..  30  11VWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAFGS-------GANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGETAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTALPTPKLVVEPGRAIAGPGTITLYEVGTVKDTAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEV...... 446
4 -109.0003vab_A mol:protein length:443 Diaminopimelate decarboxylase 1  ali model follow..  37  18....NHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADM------DTLVTYALKANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIYCFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDK--ARAAYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGLGIPYRTPNTPPPPVAYAQIVAKHIKPL-----GLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAKNFVIVDAAMNDLIRPTLYDAFHDIRPVIMNAPRIRADFVGPVCETGDYLGLDREVAKPAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLGDGERYHVVRPRRTYEELLALDSVPDWL. 437
5 -108.0005x7m_A mol:protein length:453 Diaminopimelate decarboxylase  ali model follow..  28  14VWPRNAVRQEDGVVTVAGVPLPDLAEEYGTPLFVVDEDDFRSRCRDMATAFGG-------PGNVHYASKAFLTKTIARWVDEEGLALDIASINELGIALAAGFPASRITAHGNNKGVEFLRALVQNGVGHVVLDSAQELELLDYVAAGEGKIQDVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGSAFEAAKAANNAENLNLVGLHCHVGSQVFDAEGFKLAAERVLGLYSQIHSEGVALPELDLGGGYGIAYTAAEEPLNVAEVASDLLTAVGKMAAEIDAPTVLVEPGRAIAGPSTVTIYEVGTTKDDKTRRYIAVDGGMSDNIRPALYGSEYDARVVSREGDPVSTRIVGSHCESGDILINDEIYPDITSGDFLALAATGAYCYAMSSRYNAFTRPAVVSVRAGSSRLMLRRETLDDILSLEAL..... 446
6 -105.0004xg1_A mol:protein length:427 Diaminopimelate decarboxylase  ali model follow..  40  8.........NDGRLFVEGLPVEQVVKKTGTPAYIYSRATIERHWQAFDSAAGKH------PHLICYAVKANSNLAVLNLMARMGSGFDIVSVGELMRVIQAGGDPKKIVFSGVGKTEIEISAALQANIMCFNVESISELYRINSVAKALNVKAPISIRINPNIDAGTHPYISTGLKENKFGIEIEQ--ALDVYKIASDLEFLEIKGVDCHIGSQLTEIAPFIEALDKLLILIDLLAEKGITISHLDLGGGLGVPYDDETPPEPAEYMTAIINRM------AGRSLKLIFEPGRAIMANAGVLVTKVEFLKLNDYKNFAIVDAAMNDLIRPALYSAWQNIIPLNTDRPVRSYDIVGPICETGDFLGKERQLA-LAEGDYLVIRSTGAYGSTMSSNYNSRCRAAEILVDGEKAFIVREREELKDLWRGEHILP... 420
7 -103.0002p3e_A mol:protein length:420 Diaminopimelate decarboxylase  ali model follow..  42  9....PYLEYRDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFP--------DALICYAVKANFNPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIRE--AQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQKGFDIKYLDIGGGLGIKYKPEDKEPAPQDLADLLKDLLENV-----KAKIILEPGRSIMGNAGILITQVQFLKDKGSKHFIIVDAGMNDLIRPSIYNAYHHIIPVETERKKVVADIVGPICETGDFLALDREIEEVQRGEYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVEPSL...... 418
8 -102.0002qgh_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  38  4........SSSGLVPRGSFNYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGR------KSLICYALKANSNLSILSLLAHLESGADCVSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKE--ALEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSYE-NEETIKLYDYAQGILNALQGL-----DLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVIVDAGMNDFLRPSLYHAKHAIRVITPGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSMASQYNSRPKLLELALEDHKIRVIRKREALEDLWRLE....... 412
9 -101.0003n2b_A mol:protein length:441 Diaminopimelate decarboxylase  ali model follow..  38  18.AMDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDY------PHLICYAVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDR--AAQVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLGVVYRDEL-PPQPSEYAKALLDRLERHRD----LELIFEPGRAIAANAGVLVTKVEFLKHTEHKNFAIIDAAMNDLIRPALYQAWQDIIPLRPQGEAQTYDLVGPVCETSDFLGKDRDLV-LQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLP... 434
10 -100.0002j66_A mol:protein length:428 BTRK  ali model follow..  25  1.............MNLDQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNP-------AIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFGST-AIKMGGVPRQFGMDESM--LDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERGIVCECINLGGGFGVPYFSHEKALDIGKITRTVSDYVQEARDRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVIVDGGMHHHAASTFRGRSMRVREDSGRRELEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQLQTESNL 423
11 -99.6002yxx_A mol:protein length:386 Diaminopimelate decarboxylase  ali model follow..  38  4....................LRKVAEIHGTPTYVYFEETLRKRSRLVKEVFEGV------NLLPTFAVKANNNPVLLKILREEGFGMDVVTKGELLAAKLAGVPSHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFEEMEIWRELN---PEGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPLED-----LDSFMERFRSMNIRGLHVHIGSQITRVEPFVEAFSKVVRASE-----RYGFEEINIGGGWGINY--SGEELDLSSYREKVVPDLKRF------KRVIVEIGRYIVAPSGYLLLRVVLVKRRHNKAFVVVDGGMNVLIRPALYSAYHRIFVLGKQGKEMRADVVGPLCESGDVIAYDRELPEVEPGDIIAVENAGAYGYTMSNNYNSTTRPAEVLVRNGRISLIRRRETEMDIFKDVVM..... 386
12 -98.6001knw_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  28  3......HSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDV-----------VRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPDDIVFTADVIDQATLERVSELQI-PVNAGSVDMLDQLGQVSPG----HRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPA---ALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVR----QVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAAHAPTVETVVAGPLCESGDVFTQQRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELL..... 420
13 -87.1005gjo_A mol:protein length:394 Lysine/ornithine decarboxylase  ali model follow..  24  1.........AMKNFRLSEKEVKTLAKRIPTPFLVASLDKVEENYQFMRRHLP--------RAGVFYAMKANPTPEILSLLAGLGSHFDVASAGEMEILHELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAVPG----ADVLVRIAVRNNKALVDL------NTKFGAPVEEALDL----KAAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARRLFDEAEEMGMHLTDLDIGGGFPVPDCKGL-NVDLAAMMEAINKQIDRL---FPDTAVWTEPGRYMCGTAVNLVTSVIGTKTRGEQPWYILDEGIYGCFSGIMYDHWCYPLHCFGKGNKKPSTFGGPSCDGIDVLYRDFMAPELKIGDKVLVTEMGSYTSVSATRFNGFYLAPTIIFEDQPEYAARLTED-DDVKKKAAV..... 394
14 -85.1002oo0_A mol:protein length:471 Ornithine decarboxylase  ali model follow..  20  10LMNNFGNEEFDCHFLDEGFTAKDISSDDKDAFYVADLGDILKKHLRWLKALP--------RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHP----------KAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL----ERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKL---KFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKTFMYYVNDGVYGSFNCILYDHAHVKPLLQKDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAQLMQQFQNPDFPPEVEEQDASTL 447
15 -85.0003btn_A mol:protein length:448 Antizyme inhibitor 1  ali model follow..  15  5....IDDANYSVGLLDEGTNLGNVIDNGKNAFFVGDLGKIVKKHSQWQTVVAQ--------IKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHP----------NAKVLLHIATEDNIGGEDGNMKFGTTLKNCRHL----ECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGTEIQLE------EVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGEPAFVYYMNDGVYGSFASKLSEDEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDEMQDAGITSDAMMKNFFFAPSCI 436
16 -83.6002plj_A mol:protein length:419 lysine/ornithine decarboxylase  ali model follow..  19  23....DIHSLTSPVLSAEEIHIEASVEQFGAPLLLLDCDVIRQQYRALKNALP--------NVTLHYALKPLPHPVVVRTLLAEGASFDLATTGEVELVASEGVPADLTIHTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYRDDVELLVRLSFRNSE----------AFADLSKKFGCSPEQALVI----ETAKEWNIRIKGLSFHVGSQTTNPNKYVEAIHTCRHVMEQVVERGPALSTLDIGGGFPVNYTQQV--MPIDQFCAPINEALSLLPET---VHVLAEPGRFICAPAVTSVASVMGQAEREGQIWYYLDDGIYGSFSGLMFDDARYPLTTKQGGELIPSVLSGPTCDSVDVIAENILLPKLNNGDLVIGRTMGAYTSATATDFNFFKRAQTIALNEFVASSERMI................. 412
17 -83.5004zgz_A mol:protein length:438 Antizyme inhibitor 1  ali model follow..  17  7.....DDANYSVGLLDEGTDLGNVIDNGKNAFFVGDLGKIVKKHSQWQNVVAQ--------IKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPN----AKVLLHIA------TEDNIGGEEGNMKFGTTLKNCRHL----ECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLE------EVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPSGEPAFMYYMNDGVYGSFASKLSEDEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSYEMQDAGITSDSMMKNFFVPSCI. 437
18 -82.0003n29_A mol:protein length:418 Carboxynorspermidine decarboxylase  ali model follow..  16  6MASMTGGQQMGRDLYDKDHPFTMFYEKIQTPAYILEEDKLRKNCELLASVGEK------SGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYM--DKEIHTYSPAFKEDEIGEIASLSH-HIVFNSLAQFHKFQSKTQK----NSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKD---------FENVDLNAIEGLHFHALCEESADA----LEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYD----VEKLIALCKNFSDKY-----GVQVYLEPGEAVGWQTGNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARIKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN....... 412
19 -81.4003mt1_A mol:protein length:365 Putative carboxynorspermidine decarboxylase protein  ali model follow..  17  2...........................IETPYYLIDKAKLTRNMERIAHVREKS------GAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGK--ETHAYSVAYGDNEIDEVVSHAD-KIIFNSISQLERFADKAAG----IARGLRLNPQVSSSSFDLADPARPFSRLGEWDVP---------KVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGAL---IARVDWVSLGGGIHFTGDDYP----VDAFSARLRAFSDRY-----GVQIYLEPGEASITKSTTLEVTVLDTLYNGKNLAIVDSSIEAHMLDLLIYRETAKVL---PNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSL....... 364
20 -80.8001f3t_A mol:protein length:425 ORNITHINE DECARBOXYLASE  ali model follow..  21  28...................KISMNTCDEGDPFFVADLGDIVRKHETWKKCLPR--------VTPFYAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARDSGVDVMTFDCVDELEKVAKTHPK----AKMVLRIS------TDDSLARCRLSVKFGAKVEDCRFI----EQAKKLNIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHILDIGGGFPGTR---DAPLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVIAKKVTPGVQTDVGAHAESNYVNDGVYGSFNCILEPIPNEKLYPSSVWGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVSGLPHVVRELKSQKS............ 425
21 -80.3007odc_A mol:protein length:424 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  19  1.MSSFTKDEFDCHILDEGFTAKDISSDDKDAFYVADLGDILKKHLRWLKALP--------RVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHP----------KAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL----ERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSE---DTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKTFMYYVNDGVYGSFNCILYDHAHVKALLQKDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMQLMKQIQSHG............. 424
22 -79.7003nzq_A mol:protein length:666 Biosynthetic arginine decarboxylase  ali model follow..  16  57ISVCPDPDVPEARVDLAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAGAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQG-SGKWQSSGGEKSKFGLAATQ--VLQLVETLREAGRLSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQYGLNEYANNIIWAIGDACEELPHPTVITESGRAVTAHHTVLVSNIIGVERNEYTVPT-APAEDAPRALQSMWETWQEMHEPGTRRSLREWSQMDLHDIHIGYSSGIFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQERMADKMYVNFSLFQSMPDAWGIDQLF. 505
23 -79.0002nv9_A mol:protein length:372 A207R protein, arginine decarboxylase  ali model follow..  16  7...................NILKAHPHQTKSFYVSSPKIVEDLIDQWTILFP--------RVTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHTYHPN----CKMILRIRCDDPN------AAVQLGNKFGANEDEIRHL----EYAKQLDIEVIGISFHVGSGSRNPEAYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIDEGE---LSTYMSDYINDAIKDFFPE-DTVTIVAEPGRFFAEHYSVLATQVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAYTNVLTTSFNGFGEYDVYYI............................ 372
24 -77.4004aib_A mol:protein length:395 ORNITHINE DECARBOXYLASE  ali model follow..  20  1........MKQTSLEVKEFALNLISENQPLGFWIFDTEGVEKAVERWKKNMP--------TVRPCFAVKCNPEPHLVKLLGELGCGFDCASLNEIKEVLDLGFNPEDITYSQTFKPYNQLIEASHLGINHTIVDSIDEVQKIAKYAPK----MGIMIRIMENDTSAGHVF------GEKFGLHDDEVEIV----KEIKDKGLNLDGVHFHVGSDSHNSEVFTKALTKARNTVTLAEQFGMKPYLIDIGGGFSQVAPFEEFAATIEKTIKELEFP--------ERTRFIAEPGRYMASNAFHLVSSLHGKRVRIQNGYTSGDGLHGSFGCCIWFEKQKSCECITQNTKMYESIIYGPSCNGSDKVATQELPEMEPGKDWLLFPNMGAYTISMATNFNGFEERNHVIYLPLKSTKIIQI................. 394
25 -75.1003n2o_A mol:protein length:648 Biosynthetic arginine decarboxylase  ali model follow..  18  32..DQGEMYVSPRSDNAHQIQLSKIVKQLNVPVLVRFPQILHQRVHSICDAFNQAIEEYQNKYLLVYPIKVNQQREVVDEILASQLGLEAGSKPELLAVLAMAQHASSVIVCNGYKDREYIRLALIGEKLFIVLEKMSELDLVLREAKSLGVTPRLGIRIRLASQG-AGKWQASGGEKSKFGLSASQ--VLNVISRLKKENQLDLQLVHFHLGSQMANIRDVRNGVNESARFYCELRTLGANITYFDVGGGLAIDYDGTRSQYGLVEYARNIVNTVGDVCKDQPMPVIISESGRSLTAHHAVLISNVIGTETYKPETVTEPEEDFQSLPDSWGIDQVFPVLPLSGNAADRRAVMLDITCDSDGAIDAYVDGQGIEEPYLMGFFLVGAYQEILGDMHNLFGDTHSVVVNVGNIDFINEGDTVEDMMRYVHIDVDQI 603
26 -71.8003nzp_A mol:protein length:619 Arginine decarboxylase  ali model follow..  23  9.WGNENFIIKNGKVCIKKPAIIDIVKEYKGPLLLRFPHLIQKQIENIYGNFNKARKEFGGGFNAVYPLKVNQYPGFVKNLVKLGYGLEAGSKAELLLAMAYNNEGAPITVNGFKDRELINIGFIAAEMGTLTIEGLNELEAIIDIAKERKPKPNIGLRVRLHS-AGVGIWAKSGGINSKFGLTSTE--LIEAVNLLKENKLLEFTMIHFHLGSQITEIHPLKKALNEAGNIYTELRKMGKNLKAINLGGGLAVEYSQFKNEYTLREYANDVVFILKNIAEQKKEPDIFIESGRFVAANHAVLIAPVLELFSQEYAENKLILKKQNPKLIDELYDLYKSIKPSNDEEPTRSASIWDITCDSDGEISYSHDVDVEKENYFLGFFLVGAYQEVLGMKHNLFTHPTEAIISINEVEGIIEAQSILDTLEDLDYDIHAI 570
27 -20.0003wqc_A mol:protein length:390 D-threo-3-hydroxyaspartate dehydratase  ali model follow..  13  1................GAMSMQDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQ------GVRLRPHVKTSKSVPVAAAQRAAGAGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDG--------------HRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVT-------------------------VRAGVYVFFDALSVLATVIGHQADKGW--AIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPG-ILARADGAAEADIATRFPLGTRLRI..................................................... 351
28 -18.9004v15_A mol:protein length:379 D-THREONINE ALDOLASE  ali model follow..  14  21........................LARVDTPSLVLDLPAFEANLRAMQAWADRH------EVALRPHAKAHKCPEIALRQLALGAGICCQKVSEALPFVAAGIRDIHISNEVVGPAKLALLGQLARAAKIVCVDNAENLAQLSAAMTRAGAEIDVLVEVDVGQ--------------GRCGVSDDA-TVLALAQQARALPGLNFAGLQAYHGTREERAAVCRQAARIAASYAQLLRESGIACDTITGGGTGSVEFDAASGVYT-------------------------LQAGSYAFMDSDYSLFVLSTVMSTPAPGRVILDAGLKSTLTYAAINDEHGVVRVEPGAQAPALGVPSHVDPTFNLH---DGLVVVKDGVVQDVWEIAARGFSR........................................... 379
29 -18.4003llx_A mol:protein length:376 Predicted amino acid aldolase or racemase  ali model follow..  12  9........................IAHPDTPYLLIDEAKLKSNINYLKQRVESL------GSHLRPHLKTLRTLEAAGYLLDSKSPATVSTLAEAEAYAKAGYTDLLYAVGIAPAKLKRVAALRQQGINHILLDNITQAQAVVDYAAEFGQDFSVFIEIDSDD--------------HRGGIKPSD----SKLLTIAKTLGEHFTGLMTHAGTEQGLKNFAKQECDAVRIARNNLETAGIHCAITSVGSTPTAHFGEDFSDIS-------------------------VRAGVYTTFDLVAMSVVTTVIGHNKEKNWLLTDSGWMALSRDSNRDFGYGQVCKIDGSVLDGLCVNSTSQEHGVILSDAYQLEDFPVGHQLRIMPN--HACATAAMHPVY-----HVLMSDGS....................... 366
30 -18.2003anu_A mol:protein length:376 D-serine dehydratase  ali model follow..  15  7........................LDTLPTPALTIDRTTARRNAERMRERCRAL------GVRLRPHVKTHKTLEGGLLATGGTRGIAVSTLAEARFFADGGFDDILLAYPVPTARLEECAGLARRLDAFVLLDRPEALASLRQRPLGHGKRWLVWLKLDCGN--------------GRAGVRPTDALELAQAIANDAPEEVTLVGVYAHCGGADTIQAIARTTTNAVLSFVAALRQAGVPCPQASIGSTPSCSHPIPEMSQLTE-----------------------LHPGNYIFYDAIRVLTRV--IGHYAHRGQLLVDCGWAALSLHAAIDGHPELRLVGLTQEHGLLEHAGG----------QMDFGRFPVGSVLALIPYHA................................................ 348
31 -17.3003gwq_A mol:protein length:426 D-serine deaminase  ali model follow..  13  41........................NEDVSLPAAVLYADRVEHNLKWMQAFVAEY------GVKLAPHGKTTMAPQLFRRQLETGAGITLATAHQVRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFCLVDSVEGVEQLGEFFKSVNKQLQVLLELGVPG--------------GRTGVRDAAQRNAVLEAITRYPDTLKLAGVELYEGV-LKEEHEVREFLQSAVAVTRELVEQERFARAPAVLSGAGSAWYD-------------VVAEEFVKASETGKVEVVLRPGCYLTHDVGIALQLWAYVQSIPEPDRAIIGLGKRDSAFDAGMPEPARHYRPGNEAPRDIAASEGEIFGLMD-YLRIPAGADLKVGDMIAFDIS--HPCLTFDKWR------QVLVVDPAYRVTEVIETF.............. 425
32 -15.2004kbx_A mol:protein length:388 Uncharacterized protein YhfX  ali model follow..  10  1XMFVEALKRQNPALISAALSLWQ-QGKIAPDSWVIDVDQILENGKRLIETARLY------GIELYLMTKQFGNPWLAEKLLALGYGIVAVDYKEARVMRRAGLPVAHQGHLVQIPCHQVADAVEQGTD-VITVFTLDKAREVSAAAVKAGRIQSVLLKVYSDDDF---------YPGQESGFALKV--LPEIVAEIQNLPGLHLAGLTHFPCDEAVGKVLPTPNLHTLIQARDQLAKSGIALEQLNAPSATSCTSLPLLAQYGVTH----------------------AEPGHALTGIAMLWLSEISHHFRGDSYCY-------------GYYRRGHAQHALVFTPENQKITETNLKTVDDSSIYTLPLAGEFPVSSAVVLFVTRSDVVLVSGIHRGEPEIVGRYDSLGN........................ 384
33 -14.3004beu_A mol:protein length:392 ALANINE RACEMASE  ali model follow..  12  3.............LHIDTALPDAAQIQQSNSWLEISLGQFQSNIEQFKSHMNA-------NTKICAIMKADAIRGLMPTIIAQGIPVGVASNAEARAVRESGFKGELIRVRSA--SLSEMSSALDLNI-EELIGTHQQALDLAELAKQSGKTLKVHIALN-----------DGGM--GRNGIDMTTEAGKKEAVSIATQPSLSVVGIMTHFPYNADEVRAKLAQFKESSTWLMQQANLKREEITLHVANSYTALNVP-EAQLDMVRPGGVLFGDLPTNPEYPSIVSFKTRVSSLHHLPKDSTVGYDSTFTTSRDSVLANLPVGYSDGYPRKMGNKAEVLI------NGQRAKVVGVTS---NTTVVDVTIKGVLPGQEVVLFGQ.................................................. 348
34 -14.2004dza_A mol:protein length:407 lysine racemase  ali model follow..  11  31...................QVAQVQPAIVNNSWIISRSALDFNVKKVQSLLGK-------QSSLCAVLKGDALSLVAPIMIENNVKIGVTNNQELKEVRDLGFKGRLMRVRNA--TEQEMAQATNYNV-EELIGDLDMAKRLDAIAKQQNKVIPIHLALN------------SGGM-SRNGLEVDNKSGLEKAKQISQLANLKVVGIMSHYPEDANKVREDLARFKQQSQQVLEVMGLERNNVTLHMANTFAT-ITVPESWLDMVRVGGIFYGDTIASTDYKRVMTFKSNIASINYYPKGNTVGYDRTYTLKRDSVLANIPVGYADGYRRVFSNAGHALI------AGQRVPVLGKTS---NTVIVDITLNNIKPGDEVVFFGKQG................................................ 373
35 -13.9001vfh_A mol:protein length:386 alanine racemase  ali model follow..  15  1.......................MNETPTRVYAEIDLDAVRANVRALRARAP--------RSALMAVVKSNAAVPCARAAQEAGAALGTATPEEALELRAAGIQGRIMCWLWT--PGGPWREAIETDI-DVSVSGMWALDEVRAAARAAGRTARIQLKADTGL--------------GRNGCQPADWELVGAAVAAQAEGTVQVTGVWSHFAADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPAT-LTLPETHFDLVRTGLAVYG-VSPSPELGTPAQLGLRPAMTLRAPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLV------AGKIRRAAGRIA---DQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWRIGGRVPRVYLGGLE........................ 380
36 -13.6004dyj_A mol:protein length:409 broad specificity amino acid racemase  ali model follow..  11  34....................TNALTVQNSNAWVEVSASALQHNIRTLQAELAG-------KSRLCAVLKADAIGLVMPSIIAQGVPVAVASNEEARVVRASGFTGQLVRVRLA--SLSELEDALQYDM-EELVGSAEFARQVDAIAARHGKTLRIHMALN-----------SSGM--SRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAEDKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYQRAMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLI------NGHRIPVVGKVS---NTLMVDVTFPDVKGGNEVVLFGKQA................................................ 375
37 -13.5004bf5_A mol:protein length:417 ALANINE RACEMASE  ali model follow..  13  46..................................VDLGAFEHNIQTLKDRLGD------KGPKICAIMKADAIDLLVPSVVKAGIPIGIASNEEARVAREKGFTGRLMRVRAA--TPAEVEQALPYKM-EELIGSLVSAQGIADIAQRHHTNIPVHIALN-----------SAGM--SRNGIDLRLADSKEDALAMLKLKGITPVGIMTHFPEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITIHAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGYDRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLI------QGQKVPVVGKTS---NTIMVDVTLKGVKPGDEVVLFGRQG................................................ 374
38 -13.3001xfc_A mol:protein length:384 Alanine racemase  ali model follow..  14  1....................MTPISQTPGLLAEAVDLGAIEHNVRVLREHAG--------HAQLMAVVKADGATRVAQTALGAGAALGVATVDEALALRADGITAPVLAWLHP--PGIDFGPALLADV-QVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGL--------------NRNGVGPAQFAMLTALRQAMAEDAVRLRGLMSHMVADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSATMARPDLTFDLVRP-------AVYGLSPVPALGDMGLVPAMTVKCRAGEGVSYGHTWIAPRDTNLALLPIGYADGVFRSLGGRLEVLI------NGRRCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRGEPTAQDW....................................... 355
39 -13.0004y2w_A mol:protein length:388 Alanine racemase 1  ali model follow..  13  13..................................VYLDAITHNFREIKKIVGK-------NVKIMAVIKGDAASYVAKFLEKEGVDFGVATTEEALELREKGIKTPILIFGYT--PPTQLRQIVKHDL-TQTVYDIKYAKELEKESLKQNKRAKVHIKIDTGL--------------GRIGYIDFD-LAQKEILEMANMRGLILEGIYSHFAASEDDRDYCKEQFDKFMNLISSLEKKRLKIPLKHIANAAAILNLNYSHRPGIILFGAYPSKRVERKVELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKRKSVIATIPVGYADGLDRRLSNNYKLLL------KGKYVPIVGRVC---DQCMIDVTVEGVEIGDEVVIIGIETIPQEVFSRISR--RVPRVYFYDGIKIGEVN.................. 385
40 -12.9004lus_A mol:protein length:385 Alanine racemase  ali model follow..  16  1.......................MQKITVPTWAEINLDNLRFNLNNIKNLLEE-------DIKICGVIKADAAVEVAKLLEKEKVDLAVARTAEGIELRQNGITLPILNLGYT--PDEAFEDSIKNKI-TMTVYSLETAQKINEIAKSLGEKACVHVKIDSGM--------------TRIGFQPNE-ESVQEIIELNKLEYIDLEGMFTHFAADEVSKEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLR---LNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKNPKVLI-------KGEVFDVVGRIC---DQIMVRIKDIDIKVGDEVILFGLGTINYEVLCMISR--RVDRVYMENNELVQINS.................. 381
41 -12.8005fac_A mol:protein length:410 Alanine racemase  ali model follow..  13  8.........VPRGSHMSETTARRDADAVLRARAEIDLAALRANVRALRERAP--------GAALMAVVKADAAIPCARAAVAAGATLGTATPQEALALRAAEPPDDVRIMCWLWTPGGPWREAVEARL-DVSVSAMWAMEEVTGAARAAGVPARVQLKADTGL--------------GRGGCQPGA-RLVGAALRAEEEGLLRVTGLWSHFAADEPGHPSIAAQLTRFREMTAYAEQRGLRPEVRHIANSPAT-LTLPDAHFDLVRPGIAMYG-VSPSPEIGTPADFGLRPVMTLAAPGGHGVSYGHHYTTPGETTLGLVPLGYADGIPRHASSSGPVLV------DGKWRTVAGRIA---DQFVVDLGGDRPEPGAEAVLFGPGDRGEPTAEDW....................................... 378
42 -12.2001w8g_A mol:protein length:234 HYPOTHETICAL UPF0001 PROTEIN YGGS  ali model follow..  10  2.....................................NDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDQELGVTGLEWHFIGPQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQIN------------ISDENSKSGIQLAELDEL--AAAVAELPRLRLRGL-MAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLG-------------------------MSDDMEAAIAAGSTMVRIGTAIFGA........................................................................................................................................ 228
43 -12.0003sy1_A mol:protein length:245 UPF0001 protein yggS  ali model follow..  11  3.....................................NDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDQELGVTGLEWNFAGPQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQIN------------ISDENSKSGIQLAELDEL--AAAVAELPRLRLRGL-SAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALG-------------------------QSDDMEAAIAAGSTMVAIGTAIFGA........................................................................................................................................ 229
44 -11.6005irp_A mol:protein length:394 Alanine racemase 2  ali model follow..  14  1.......................MIKLCREVWIEVNLDAVKKNLRAIRRHIPH-------KSKIMAVVKANGSIEVARHALEHGASLAVASVEEGIVLRKAGITAPILVLGFT--SLSCVKKSAAWNI-TLSAFQVDWMKEANEILEKEASANRLAIHIN----------VDTGM--GRLGVRTKE-ELLEVVKALKASKFLRWTGIFTHFSADEPDTTLTKLQHEKFISFLSFLKKQGIELPTVHMCNTLGIGLYGLYPSAYIKQLNLVKLEPALSLKARIAYVKTMRTEPRTVSYGATYIAEP--------NEVIATLPIGYADGYSRALSNRGFVLH------RGKRVPVAGRVT---DMIMVSLENGEGKQGDEVVIYGLNTINYEVVSTLSR--RIPRFYIRDGEIFKVST.................. 389
45 -11.6002dy3_A mol:protein length:361 Alanine racemase  ali model follow..  13  8..................................IDLDAIAHNTRVLKQMAG--------PAKLMAVVKANAVEKVAPVIAAHGADFGVATLAEAMQLRDIGISQEVLCWIWT--PEQDFRAAIDRNIDL----AVISPAHAKALIETDAEHIRVSIKIDSGL--------------HRSGVDEQE--WEGVFSALAAAPHIEVTGMFTHLAADEPENPETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLH---------------------------MVRPGLAFYGPAMTWEAKVSVVKQIEAGFVAVVPAGYADGMPRHAQGKFSVTI------DGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIF--GENGHDATD......................................... 336
46 -11.1003e5p_A mol:protein length:371 Alanine racemase  ali model follow..  12  13..................................IDTQAITENVQKECQRLPE-------GTALFAVVKANGAVESAKAAKKGGATFCVALLDEAIELREAGVQDPILILSVV--DLAYVPLLIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKVDTGM--------------GRIGFLTPE-ETKQAVRFVQSHKEFLWEGIFTHFSADEIDTSYFEKQAGRFKAVLAVLEELPRYVHVSNSATALGVAMYGLNPSGNKLAPSYALKPALRLTSELIHVKRL----------AAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQGFTVLV-------NGKRCEIVGRVC---DQCMIRLA-EEVPVGPVVTLVGKDG................................................ 338
47 -11.1005nlc_A mol:protein length:228 PipY  ali model follow..  16  1...........................................MAQIAERLASLRSQLPPSVQLIAVSKNHPAAAIREAYAARHFGENRVQEAIAKQAELTDLPDLTWHLLGKLQS-NKARKAVEHFDWIHSVDSWALAERLDRIAGELGRSPKLCLQVK------------LLPDPNKAGWDPADLRAE--LPQLSQLQQVQIRGL-MVIAPLGLTAAETQALFAQARTFAAELQQQAPQLRLTELSMGMSSDW------------------------------PLAVAEGATWI-RVGTQLFGPRSLE............................................................................................................................ 222
48 -11.0003kw3_A mol:protein length:376 Alanine racemase  ali model follow..  14  25..................................IDVRAIVANYRTLAQHVA--------PTECSAVVKANAAHKIAPALYQAGCRTFFVAQIEEALQLKAVLPENVMIALLNGFPHKAEEFVAQSGIIPL-LNSWSTIEDWQTLCQKKNKKFPAIIQVDTNM--------------SRLGLDKKELQ--KLIKNPTIFEKAEIKYILSHLANNNKQLAAFKRVLAQLPTCKVSFANSGFYFDLVRPGIALYGVDPHGKHPTPLKAVVKVEAQVLQ------------IDAGIPVGYRESFMTRR--------PSTLATISIGYADGWPRILSNKGTVYF------NGHKLPIVGHISMDSIIVDATDLDKKPQRGDWVELIGPHQPLEKVSTDTNT---PHEILTSLGK........................ 369
49 -10.6003ha1_A mol:protein length:397 Alanine racemase  ali model follow..  12  14..................................VDLDAIYNNVTHIKEFIPS-------DVEIFAVVKGNAYVPVAKIALEAGATLAVAFLDEALVLRRAGITAPILVLGPS--PPRDINVAAENDV-ALTVFQKEWVDEAIKLWDG-SSTMKYHINFDSGM--------------GRIGIRERK-ELKGFLKSLEGAPFLELEGVYTHFAADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQ-GITFNAVRIGIAMYG-LSPSVEIRPFLPFKLEPALSLHTIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGFEVLV-------NGKRVPIVGRVT---DQFMIHLP-CEVPLGTKVTLIGSGTINYEIITTISF--RVPRIFIRNGKVVEVIN.................. 384
50 -10.5002odo_A mol:protein length:357 Alanine racemase  ali model follow..  12  8..................................IDLQALRHNYQLAREV---------TGAKALAVIKADAAVRCAQALEAEADGFAVACIEEALELRAAGIRAPILLLEGF--EADELPLIVEHDF-WCVVHSLWQLDAIEQAR--LAKPIHVWLKLDSGM--------------HRVGLHPND--YKAAYQRLQASANVAKIVLMSHFARQVAVFLGARADLTAEISLRNSPAVLGWPRVPSDW----GLMLYGSSPFDEPQATASRLQPVMTLESKVICVREL----------PAGEPVGYGARFITPKPMRIGVVAMGYADGYPRQAPTGTPVFV------DGVRSQLLGRVS---DMLCIDLTVPQAGLGSTVELWGKNILASEVATAADT---PYQIFCNLKRVPRLYSGN................ 357
51 -10.4003oo2_A mol:protein length:385 Alanine racemase 1  ali model follow..  13  2.....................NAMSDKYYRSAYMVDLNAVASNFKVFSTLHP--------NKTVMAVVKANASVKVARHLMENGATFAVATLDEAIELRMHGITAKILVLGVL--PAKDIDKAIQHRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGM--------------GRLGIKDTK-TYQEVIEIIQQYEQLVFEGVFTHFAC----ADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAIR--PGISLYGYYPSEYVQQKVKVHLKPSVQLIAQAGESVSYGATYTATDPTTIALLPIGYADGYLRIMQGSFVNV-------NGHQCEVIGRVC---DQTIVKVP-DQVKAGDSVILIDQHTINYEVLCNLSR--RLPRIYHDGDQRFVTNE.................. 382
52 -10.4004ecl_A mol:protein length:374 Serine racemase  ali model follow..  15  11..................................INLNNLEHNVNTLQKAMSP-------KCELMAVVKAEAMYEVTTYLEQIGVSFAVATIDEGIRLRKYGISSEILILGYTSPSRAKELCKYELTQTLIDYRYSLLL-------NKQGYDIKAHIKIDTGM--------------HRLGFSTEDKDK---ILAAFSLKHIKVAGIFTHLCAA--DVAFTNKQIGSFYKVLDWLKSSGLNIPKVHIQSSYGL-LNYPELECDYIRVGVALYG-VLSSTNDKTKLELDLRPVLSLKAKQGESVGYSRAFTATRDSLIAILPIGYADGFPRNLSCGNSYVLIGGR-----QAPIVGKIC---DQLAVDVTIPNVKTGSIATLIGKDG................................................ 340
53 -10.4001rcq_A mol:protein length:357 catabolic alanine racemase DadX  ali model follow..  14  8..................................IDLQALRHNYRLAREA---------TGARALAVIKADAAVRCAEALAAEADGFAVACIEEGLELREAGIRQPILLLEGF--EASELELIVAHDF-WCVVHCAWQLEAIERAS--LARPLNVWLKMDSGM--------------HRVGFFPED--FRAAHERLRASGKVAKIVMMSHFSRQLAAFSAASQGLEGEISLRNSPAVLGWPKVPSDW----GILLYGATPFERAHPLADRLRPVMTLESKVISVRDL----------PAGEPVGYGARYSTERRQRIGVVAMGYADGYPRHAADGTLVFI------DGKPGRLVGRVS---DMLTVDLDHPQAGLGSRVELWGFGSIPYQLLCNLKRVPR.................................. 352
54 -10.3006g56_A mol:protein length:404 Alanine racemase 1  ali model follow..  13  8.......QFEKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHP--------NKTVMAVVKANASVKVARHLMENGATFAVATLDEAIELRMHGITAKILVLGVL--PAKDIDKAIQHRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGM--------------GRLGIKDTN-TYQEVIEIIQQYEQLVFEGVFTHFAC----ADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGS-LLMDCQFCNAIRPGISLYG-YYPSEYVQQKVKVHLKPSVQLIAQAGESVSYGATYTATDPTTIALLPIGYADGYLRIMQGSFVNV-------NGHQCEVIGRVC---DQTIVKVP-DQVKAGDSVILIDQHTINYEVLCNLSR--RLPRIYHDGDQRFVTNE.................. 401
55 -10.2003co8_A mol:protein length:380 Alanine racemase  ali model follow..  11  1.....................MSLEAIHRSTRIEFSKSSLAYNVQYTKQVSG--------AKTLWLAVKSNALLQVSKIARECGVDLAVSVLDEGIAIRQAGIDDFILILGPI--DVKYAPIASKYHF-LTTVSSLDWLKSADKILG--KEKLSVNLAVDTGM--------------NRIGVRSKKDLKDEIEFLQEHSDHFSYDGIFTHFASSDNPDDHY---FQRQKNRWYELIDGLIMPRYVHVMNSGAAMYHSKELPGCNSIARVGTVVYGVEPSEGVLGPIDKLKPVFELKSPAGEGISYGSKFVTSRDTWIGTLPIGYGDGWLAEYQDFQLLI-------DGQKCRQVGQIA---DQMMVALP-HEYPIGTEVTLIGSGVPPWKITVAFSD--RLKRMVVDEG......................... 374
56 -10.2003cpg_A mol:protein length:282 Uncharacterized protein  ali model follow..  14  21...................................RAREITDGVHRVLDRIAAAEEQAGREAGSVRLLAATKTRDIGEIMAAIDAGVRMIGENRPQEVTAPDAAAEHIPFHLIGQQSNKIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEVN------------ESGEESKSGCDPAH--AIRIAQKIGTLDGIELQGL-MTIGAHVHDETVIRRGFSHLRKTRDLILASG-RCRELSMG-------MTGDMELAIAEGST------------------IVRVGTAIFGE........................................................................................................................................ 270
57 -10.0006a2f_A mol:protein length:358 Alanine racemase, biosynthetic  ali model follow..  12  8..................................VDLSAIRHNYALAKRCA--------PQRQAFAVVKANAAREVVTALHDDADGFAVACLEEAAEVRALHASARILLLEGC--EASEYALAGQLRLDLV-IQGAEQGEAFL--AAGLDIPLNVWLKLDSGM--------------HRLGFDPAA--LRAWHARLRSHPGVRELNLISHFACQLESFLGLLDLDFDQRSLANSAAVLTIPAAHMDW----GIMLYGSTPLADLSAAELGLKPAMSLGAQLISLREV----------AVGESVGYGATWIAERPARIGTVSCGYADGYPRTAPAGTPVLV------GGRRAILAGRVS---DMLAVDLDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTARVPRRYSH.................. 358
58 -9.9001bd0_A mol:protein length:388 ALANINE RACEMASE  ali model follow..  11  1.......................MNDFHRDTWAEVDLDAIYDNVENLRRLLPD-------DTHIMAVVKANADVQVARTALEAGASLAVAFLDEALALREKGIEAPILVLGAS--RPADAALAAQQRI-ALTVFRSDWLEEASALYSG-PFPIHFHLKMDTGM--------------GRLGVKDEE-ETKRIVALIERHPHFVLEGLYTHFAADEVNTDYFSYQYTRFLHMLEWLPSRPPLVHCANSAASLGIAMYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKL---------QPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLV-------DGQKAPIVGRIC---DQCMIRLP-GPLPVGTKVTLIGLETINYEVPCTISY--RVPRIFFRHKRIMEVRN.................. 379
59 -9.8803uw6_A mol:protein length:390 Alanine racemase  ali model follow..  10  1.......................MNDFHRDTWAEVDLDAIYDNVENLRRLLPD-------DTHIMASVCGNADVQVARTALEAGASLAVAFLDEALALREKGIEAPILVTGAS--RPADAALAAQQRI-ALTVFRSDWLEEASALYSG-PFPIHFHLYMDTGM--------------GSLGVKDEE-ETKRIVALIERHPHFVLEGLWTWFAADEVNTDYFSYQYTRFLHMLEWLPSRPPLVHCANSAASLGIAMYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKL---------QPGEKVSFGATYTAQTEEWIGTIPIGYKDGWLRRLQHFHVLV-------DGQKAPIVGRIL---DMCMIRLP-GPLPVGTKVTLIGLETINYEVPCTIS--YRVPRIFFRHKRIMEVRN.................. 379
60 -9.7603s46_A mol:protein length:367 Alanine racemase  ali model follow..  13  13..................................IHLGAIRQNIQQMGAHIPQ-------GTLKLAVVKANAAVAVAKAIQDDVDGFCVSNIDEAIELRQAGLSKPILILGVS--EIEAVALAKEYDF-TLTVAGLEWIQALLDKEVDLTG-LTVHLKIDSGM--------------GRIGFREAS--EVEQAQDLLQQHGVCVEGIFTHFAADEESDDYFNAQLERFKTILASMKEVPELVHASNSATTLGDAMYGLNPSGAVLDLPYDLIPALTLESALVHVKTV----------PAGACMGYGATYQADSEQVIATVPIGYADGWTRDMQNFSVLV-------DGQACPIVGRVS---DQITIRLP-KLYPLGTKVTLIGSNG................................................ 334
61 -9.6203hur_A mol:protein length:395 Alanine racemase  ali model follow..  11  1.....................MSLTAIHRPTWVSVDLDAAAHNLQEIREWTK--------AKKVYAVLKADGAIPLAKAFQETA-ALIVSNLDEALELRQADLTLPIWVLGAW--DYSDLKLFIDHDI-VITIPSLAWLQNLPDFEGT----LKVSLAIDTGM--------------TRIGFDKAD-EISAAKKIIDKNPQLDLFSVYTHFAADEAGEKSKAYFEEQLRRWQELTINQGFDPSLFSMANSATCIWHHDRISFAAIRPGQLISGVNVSNGELKMPPNLHLERIFSVCSKKDQSLSYGASERMPEDGYVATLPFGYNDGWLRRMQKSSVII-------NGKRMPIIGRIT---DQTMVKLD-RKYPIGTRVTLIGSHTIVDEIQTTLAP--RIKRIYTGDLAEVIGAN.................. 385
62 -9.0903r79_A mol:protein length:244 uncharacterized protein  ali model follow..  13  1..................................MVVMEIEARLEDVRQRIADVAEKSGRKAADVALVAVSKTFDAEAIQPVIDAGQRVFGENRVQEALKEKTSDIELHLIGPLQS-NKAADAVALFDVVESIDREKIARALSEECARQGRSLRFYVQVN------------TGLEPQKAGIDPRETVAF--VAFCRDELKLPVEGL--------MCIPPAEENPGPHFALLAKLAGQ-CGLEKLSMG-------------------------MSGDFETAVEFGATSVRVGSAIFGS........................................................................................................................................ 221

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;