current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1usu_B mol:protein length:170 AHA1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MRGSGMASMVVNNPNNWHWVDKNCIGWAKEYFKQKIVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVLast
1 -85.9001usu_B mol:protein length:170 AHA1  ali model  100  1MRGSGMASMVVNNPNNWHWVDKNCIGWAKEYFKQKIVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQV 164
2 -65.4003n72_A mol:protein length:164 putative activator of HSP90  ali model follow..  21  2.........SSGRENLYFQGERNYNKWAESYIKYNLSNLKIEKEDLTIYF---DNLQVSGNACVSIRKGKQINSFEYIIKFEWLYSK--KKEGKDYFGGSVEIPDFSTFSEENDYAINIERTESENLRFIYDSILKKEGKEKIKECLKNFQEDLLKHDKNESNK 153
3 -7.6802iqi_A mol:protein length:192 Hypothetical protein XCC0632  ali model follow..  10  44.....DSPRINVRPTPGELQVYHGAGWAQDMLEDSV---------------VRAFEDSGKIAAVARIGAGIRSDYKLAIDVRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAF-EQALTQVTTELVGWTLITGQQDSQT... 187
4 -6.8603r87_A mol:protein length:135 Putative uncharacterized protein  ali model follow..  13  15.YEDTDHSGVVYHPNFLKYFERAREHVIDSDLATLWNDHGLGFAVYKANMIFQDGVEFAEICDIRTSFTLDG-----KYKTLWRQEVWRPGASRAAVIGDIEMVCLDKE....................................................... 118
5 -6.6101s72_D mol:protein length:177 50S ribosomal protein L5P  ali model follow..  14  18..............................RIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIRAKVTLRDEFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRL-ADAVAFIESTYDVEV.. 175
6 -6.1703p9v_A mol:protein length:161 Uncharacterized protein  ali model follow..  11  80...............................................................................KITWSPI---KGEGNGVVSGSWTLSAKGDNAT--AVKFQTSAELTVPLPSLLKLAISPVIKHEFNSLVDTYMANLKKAFLE.... 155
7 -6.1205j8y_C mol:protein length:89 Polycomb protein Sfmbt  ali model follow..  16  3....................DSMPDTWNVYDVSQFLRVNDCTA-----HCDTFSRNKIDGKRLLQLTKDDIMPLLGMKV..................................................................................... 56
8 -6.0805tse_A mol:protein length:143 LPS-assembly lipoprotein LptE  ali model follow..  28............................ETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTFQI-------------EDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANRLP........... 139
9 -6.0305j8y_A mol:protein length:80 Polycomb protein Scm  ali model follow..  17  3....................DSMPIDWTIEEVIQYIESNDNSLAV---HGDLFRKHEIDGKALLLLNSEMMMKYMGLKE..................................................................................... 58
10 -5.9405v10_A mol:protein length:151 Uncharacterized protein  ali model follow..  15  21.YEDTDAGGIVYYVNYLKFMERARTERLRAL-QSQLVGDNLLFVVHSAEARYHAPAKLDDELLVSAEVEELN-----RASLKFRQQVRRASDSVLLCEGRFLVACVRADT...................................................... 126

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.