current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MDFLDFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPDSQIKVWYADFVYRYSGSDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVAAGGEYTVNGEKGVGGSIFLEGKTCLast
1 -110.0001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model  100  1MDFLDFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPDSQIKVWYADFVYRYSGSDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVAAGGEYTVNGEKGVGGSIFLEGKTC 275
2 -80.6001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  24.EMTLNQIEGRLRKLFSLKNYQEVMPPSFEYTQLYKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQ-LADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSFAIGFCCHMDTIL. 325
3 -76.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  17  18.DTLPEWICDQMTEEINLWGYDMIETPTLEYYETVQLFKLLDQQGNTLVLRPDMTAPIARLVASSDRAYPLRLAYQSNVYRAQQGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLITALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLCSGGRYDELLSQATGFGVRIDLL.. 323
4 -75.5003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  18  31.DGYPDFVETRLLSFVEDAGYEPVTSGLFEYVDTLDWIRLFDGGGDAVALRPEMTPSIARMAAPRAGRTPIRWCYCERVYRRTSGKAAESTQVGIERIGEEAVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGASDVVTFDLALHRELDYYTGLVFEMFAPGVGAPIAQGGRYDELLAPAVGFAFEVERV.. 359
5 -75.2006FTT Entity 1(prereleased)  ali follow..  18  9.DVLFEDLRHQLTQQLITHGYQLVSPPMIEFTESLQTFKIIDQTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAEALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDLGRLSENAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSQATGFSMDVSRL.. 315
6 -75.2005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  18  9.DVLFEDLRHQLTQQLITHGYQLVSPPMIEFTESLQTFKIIDQTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAEALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDLGRLSENAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSQATGFSMDVSRL.. 315
7 -65.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  31.DFPPETLFDVFHSTARKFGFEEYDSPVLESEELYQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLPAKWYSIPQCWRYEAGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRGNFRALCGGGRYDNLLTPCVGFGFGDCVI.. 339
8 -65.2003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  31.DFPPEALFDVFHATAKTFGFEEYDAPVLESEELYQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLPAKWYSIPQCWRYEAGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEGVTSDKFAPVCVIVDKMEKIPREEVLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDRGKFRALCGGGRYDNLLTPCAGFGFGDCVI.. 339
9 -63.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  19  75.DYSPRQVFDVIIRCFKRHGAEVIDTPVFELKETLLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAGVSDSKFRTICSSVDKLDKVSWEEVKNEMGLAPEVADRIGDYVQQHGGVSLVEQLKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGPCVGLSIGVERI.. 400
10 -63.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  15  14.DFYPEDIFKTAEEAAEAFGFRRIDFPSLEYLDLYQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDQRPLRWYSFPKVWRYEEGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITEEIARMAAVEDLLASYGVK-NVRYDFSIVRGLSYYTGIVFEAYDRGQFRAILGGGRYDNLASPAVGFGMGDAVI.. 317
11 -62.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  19  22.DYSPRQVFDVIIRCFKRHGAEVIDTPVFELKETLLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNPRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAGVSDSKFRTICSSVDKLDKVSWEEVKNEMGLAPEVADRIGDYVQQHGGVSLVEQLKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGPCVGLSIGVERI.. 347
12 -61.5003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  19  20.EFLPSELLDTIRRVYESYGFTPIETPAVERLEVLEKDKSGDTGSEARALKFDQTVPLAAYIARHDLTFPFARYQMDVVFRGERGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQSIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSSQTLPESEQFNLGVSELETVITGVRNLGPDKRFCIDLAIARGLNYYTGTVYETTLIGHEGSICSGGRYEELVGPGVGISIGLTRL.. 354
13 -60.3004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  16  34.DILPQDFEATVKSLLRAYGYQNIRTPIVEHTPLFEMYSFVDANGENLTLRPENTAAVVRAAIEHNYDGPKRLWYIGPMFRHERPQYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEE---------RAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLAHFEGLQRLLKAN--NVPFTINPRLVRGLDYYNLTVFEWVTDKLGATVAAGGRYDPLIEAACGWAMGIERI.. 333
14 -60.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  16  10.DILPEDIENQLDELMTFYNYKEIRTPIFESTDLFEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMNQPIKLYYNGPMFRYERKQYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMAS---------RKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLAYYEQVKAYLDDL--GIPYTEDPNLVRGLDYYTHTAFELMMDNPNTTLCGGGRYNGLLETGIGFALSIERL.. 313
15 -59.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  19  13.DLFGKEIVATARKVLEAAGALELVTPIFEETQVFEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHVWPQPVRLWMAGPMFRAERPQYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPED---------RARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPEARAHLKEVERHLERL--SVPYELEPALVRGLDYYVRTAFEVHHEEIGAALGGGGRYDGLSEPGVGFAFGVERV.. 314
16 -59.2002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  18  20.DYLPGEIEGTLKNVLGSYGYSEIRLPIVEQTPLFEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLNQEQRLWYIGPMFRHERPQYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISHVTLELNSIGSLEA---------RANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLEHFAGLCKLLESA--GIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSTVCAGGRYDGLVEPAVGFAMGLERL.. 319
17 -57.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  16  14.DVLPTQLEQHLASLMDAYGYQQIRLPIVEQTGLFEMYTFFDKGNESLTLRPEGTAGCVRALVEHNRGATPRVWYMGPMFRYEKPQYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNTLGETDE---------RTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLSHFQQLQDYLTAA--GIKFVINQKLVRGLDYYNKTVFEWTTTALGSTVCAGGRYDGLVGPAVGFAMGMERL.. 318
18 -36.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  47.QIYAEELEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHLELSSAVVGPIPLDREWGIDKPWIGAGFGLE------RLLKVKHDFKNIKRAARSESYYNGIST.................................................................... 266
19 -33.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  12  72.....GKLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMELSSALVGPIPLDREWGIDKPWIGAGFGLE--------RLLKVKHDFKNIKRAARSESYYNGIS..................................................................... 279
20 -33.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  75.....GKLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVLELSSAVVGPRPLDREWGIDKPWIGAGFGLE....................................................................................................... 256
21 -29.9005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  58.....GKLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDFKIV.................................................................................................................................................... 191
22 -29.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  58......KLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRPDPIKIFEIGPCYRKESEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLE................................................................................................................................ 209
23 -27.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  75.....GKLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSCMVYGDTL......................................................................................................................................... 219
24 -26.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  10  88.....LELEEKLAKALHQQGFVQVVTPTIITKSALALFSQVFWLDGKKCLRPMLAPNLYTLWRERLWDKPIRIFEIGTCYRKESQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSL................................................................................ 291
25 -25.2004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  75.....GKLEREITRFFVDRGFLEIKSPILIPLEYIELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSCMVYGDTL......................................................................................................................................... 219
26 -11.9002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  63...VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRMLRIADRHKRELLYGPEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRRGREFLMKDAYSFDVDEAGAR-KMFVAYLRTFARMGLKAIPMRAET................................................................................................................................................ 213
27 -11.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  12  246...IQSACCGLFREFLTSQKFVEIHTPKLIGCSS-------EGGSNIFEVKYFDRKAYLAQSPQLYKQMAIKVFEVGPVFRAENSNTREFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIR---------QYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTLDKFPAAIRPFYTMPDIDDPNYSNSYDV-FVRGQEITSGAQRIHDPEFLMKRCIEKGRFG--SWPHAGCGIGLERIT. 524
28 -10.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  11  17...IQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIKIFVLSPNIRLESRRKDEFTQLDFEI----EGAKMKDVMRLIEE------------------LIYGLFRKAEEWTGREF-PRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSF-----RPYLEIARAGKL-KPSAGAGIGVERLV. 269
29 -10.3001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  183...IQAGVCELFREYLATKKFTEVHTPKLLGASVFEVTYF--KGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNTHEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVR-KQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDF-FMRGEEILSGAQRIHDHALLQERMKAHGSYG--CPPHAGGGIGLERVV. 466
30 -10.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  17...IQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIKIFVLSPNIRLESRQKDEFTQLDFEV----ERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREVDGFWRNYDLILPYGYGEVASGGERE----WEYEKIVAKIRKAGLNE---------DSFRPYLEIA----------------KAGKL-KPSAGAGIGVERLV. 269
31 -10.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  15  212...LQSGICHLFRETLINKGFVEIQTPKIISAAS-------EGGANVFTVSYFKNNAYLAQSPQLYKQMCIKVFSIGPVFRAEDSNTHEFVGLDIEMAFNYHYH---EVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDM-FMRGEEILSGAQRIHDPQLLTERALHHGRFG--APPHAGGGIGLERVT. 491
32 -9.8203a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  10  50..PIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFEGHEFAVKPMNCPYHILLFLNEVLPLPFKVFEFGRVHRYEPSRVRGFTQDDAHIIVPGGRVIDFEEMKLVLERLFKLGVSSETFKVRLSMSDKS--KEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHR----------RGRMPFTLAPIQFAVIAVKT... 348
33 -9.6904hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  10  33..TIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNENREYCIKPMNCPGIFNQGLKSYRDLPLRMAEFGSCHRNEPSRVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNI----PFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEF----------AGFFPTWLAPVQVVIMNITD... 310
34 -9.6505xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  166...ARSMVTRCFRDHFFDRGYYEVTPPTLVQTQV-------EGGATLFKLDYFGEEAFLTQSSQLYLETCLDVFCIAQSYRAEQSRTREYTHVEAEC----PFLTFDDLLNRLEDLVCDVKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLM-------TDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGKYG--TCPHGGYGLGLERFL. 442
35 -9.6001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  272..TIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSPMQLDETESMVLRPMNCPHIYANKPHSYRELPIRIAELGTMHRYEASRVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEET----------KGAFPTWLAPKQVQIIPVNV... 555
36 -9.4003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  11  186..FLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMELYKVIDGEDEKYLIATSEQPISAEWFESPAEQLPVRYAGYSSCFRREAGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLE.................................................................................................................................. 355
37 -9.2202xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  136...LRAAATRAMREHFYNAGYVEVAPPTLVQTQV-------EGGSTLFNLEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTREYAHVEAEC----PFITLDDLMEKIEELVCDT--------------VDRLLADEEAKKLLEHINPKFQPPERPFLRM------------EYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYM---VDLLMPGVGEIVGGSMRIWKFDEPHGGYGLGLERFI. 413
38 -9.1601b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  10  139...IRSSVFKAVRDFFHENGFIEIHTPKIIATAT-------EGGTELFPMKYFEEDAFLAESPQLYKEIMMRVYEIAPIFRAEEHNTTEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKEL-------DILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDL-EYRGVEISSGGQREHRHDILVEQIKEKGRYG--MPPHGGFGLGAERLI. 414
39 -9.1303g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  19...KRAAIMAEIRRFFADRGVLEVETPCMSQA-ETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG----PVFQLCRSFRNEEMGRHEWYRPHYDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYY---KGIELANGFHELTDAREQQQRFEQRKRAARGLPQQPIDQNLLDALAA--------------------------LPDCSGVALGVDRLV. 306
40 -9.1103m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  12  158...LRSEIQWYFRKYYHDNHFTEIQPPTIVKTQC-------EGGSTLFKLQYFNEPAYLTQSSQLYLESVIKSFCMLSSYRAEQSRTVEYLHLEAEL----PFISFEDLLNHLEDLVCTV----IDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGAYKANGKYG--SCPHGGYGLGVERLV. 432
41 -9.0902j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  51.....EKLKTIMREEFEKIDAVEMLMPALLPAELWNLYRLKDRNDRDYILGPETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLEFRAIIGDGGAM............................................................................................................................................. 202
42 -9.0701wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  136...IQSLALKAFRETLYKEGFIEIFTPKIIASAT-------EGGAQLFPVKEAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPEFISMDVEM----AFADYNDVMQLLEKILHNI--------------VKTIKEEGKEEEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDL-IYKFLEIVSGSTRNHKREVLEEALKKKGDYG--MPPHAGFGMGLARLM. 405
43 -9.0203ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  10  6....RYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPRSQELNCMRQTLLFGGLETLSHNRKHLSLYLFEWGKCYRFHAAKYAEDDRLGIWICGQRVHNS-FELKAVVEQVLCRVGIETGAYTLKT................................................................................................................................................ 162
44 -9.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  12  127...VQAALVRGFRRYLDRQDFTEIFTPKVEGGSGLFGVDYFEKR-AYLAQSPQLYKQIMVGVFE-------RVYEVAPVWRMEEHHLNEYLSLDVEMGFIADEEDLMRLEEALLAEMLEEALNTAGDEIRLLG--ATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRS--------FDL-LFRGLEITSGGQRIHRYEELLESLKAKGKYG--MPPHGGFAIGAERLT. 398
45 -9.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  11  137...VKETLIMAAREWLLKDGWHEVFPPILEGGATLFKLKYFDKY--YLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTREFWHLELEA----AWMDLWDIMKVEEELVS------------------------------YMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRI-SYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYM-LASDMLAPEGYGEIIGGSDYDKLLNPHSGFGLGVERLV. 410

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.