current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MASMTGGQQMGRDPNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKLAAALELast
1 -76.9001v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N  ali model  100  1MASMTGGQQMGRDPNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKLAAALE 128
2 -65.4004apv_A mol:protein length:112 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  89  1.................MTNRLELSGIICRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGDLE..... 106
3 -65.2005wqv_A mol:protein length:104 Primosomal replication protein N  ali model follow..  98  1.................MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVAGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD....... 104
4 -64.7002pnh_A mol:protein length:107 Primosomal replication protein n  ali model follow..  98  4.................MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEAAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD....... 107
5 -58.7003fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  24  1..................MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLL-ADTPLGTEMQVQGFLAPARKDSV--KVKLHLQQARRIAGSMGRDPL.. 105
6 -56.9003k8a_A mol:protein length:103 Putative primosomal replication protein  ali model follow..  23  2.............SHMGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQ--YRQGDCATVEGFLAQKSRRSL--MPMLRIQNIKEYKG......... 103
7 -54.6004fdb_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  22  1.................AINRLQLVATLVEREVMRYTPAGVPIVNCLLSYSGQAMEAQTARQVEFSIEALGAGKMASVL-DRIAPGTVLDCVGFLARKHRSSK--ALVFHISGLE............. 95
8 -54.6003en2_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  22  1.................AINRLQLVATLVEREVMRYTPAGVPIVNCLLSYSGQAMEAQAARQVEFSIEALGAGKMASVL-DRIAPGTVLECVGFLARKHRSSK--ALVFHISGLE............. 95
9 -51.7001z9f_A mol:protein length:153 Single-strand binding protein  ali model follow..  18  1.........MGSDKIMSFFNKIILIGRLVRDPEERYTLSGTPVTTFTIAVDRVPRKAPDDAQTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRWETPTGEPEVVANVVRFMDRKPAETVSET 124
10 -51.1002vw9_A mol:protein length:134 SINGLE-STRANDED DNA BINDING PROTEIN  ali model follow..  17  1.................MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKHTITADSLQFMDKKSDNPQANA 116
11 -50.4003vdy_A mol:protein length:116 Single-stranded DNA-binding protein ssbB  ali model follow..  17  4.................MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEAD-YVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVTEVLADTVRFMDPKPREKAAD. 116
12 -48.6005yyu_A mol:protein length:112 Single-stranded DNA-binding protein  ali model follow..  21  1.................MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREAD-FINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQTEVVADSVQFLEPK........ 106
13 -48.1005xgt_A mol:protein length:111 Single-stranded DNA-binding protein  ali model follow..  20  1.................MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREAD-FINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRTEVVCDSVQFLEP......... 105
14 -46.2003tqy_A mol:protein length:158 Single-stranded DNA-binding protein  ali model follow..  12  1...........SNAMARGVNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVTEIIANEMHMLDNRGGGNSGNY 123
15 -45.2005yun_A mol:protein length:121 Single-stranded DNA-binding protein  ali model follow..  16  4.................GVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESWKQTGQQQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQTEIVVDNMQLLGGR........ 115
16 -44.9005odn_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  15  14.....SENLYFQGAMARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTDDGNEVQNTEWHDVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTEVKAQEMMFLDSNRQGGADMD 141
17 -44.4005odp_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  15  14.....SENLYFQGAMARGVNKVILIGNLGDKPELRYTGSGTAVCNMSLATNETYTDDGNEVQNTEWHDVVAWGRLGEICNEYLKKGSQVYFEGKLQTRSWEDRDNNTEVKAQEMMFLDSNRQGGADMD 141
18 -44.0002cwa_A mol:protein length:263 Single-strand binding protein  ali model follow..  18  4.................GLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLLSNGGEREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQWERRRSELQIRADFLDPLDDRGKERAEDS 118
19 -43.4002dud_A mol:protein length:133 Single-stranded DNA-binding protein  ali model follow..  19  14.................SLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSLGDVSQKTTWHRISVFPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVTTIIADNIIFLSDQTKEKE... 133
20 -42.8002fxq_A mol:protein length:264 Single-strand binding protein  ali model follow..  18  4.................GLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKKKSEVQVRAEFIDPLEGRGRETLEDA 118
21 -42.6001eqq_A mol:protein length:178 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  12  5.................GVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQTEVVVNVGGTMQMLGGRQGGGA 121
22 -42.3003koj_A mol:protein length:108 uncharacterized protein ycf41  ali model follow..  14  4.................HMNSCILQATVVEAPQLRYAQDNTPVAEMVVQFPGLSSK-----DAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSLLKREKQTELTVTRVHH............ 102
23 -41.9003ulp_A mol:protein length:124 Single-strand binding protein  ali model follow..  16  3...............EKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRNTNELKSKTDWHRIVVYDQIVDLIDKYLRKGRRVYVQGSLHTRKWHTPKQITEIILSDLIFLDDKRNFN.... 124
24 -41.8006cqk_A mol:protein length:119 SsDNA-binding protein essential for mitochondrial genome maintenance  ali model follow..  10  1................MDFSKMSIVGRIGSEFTEHTSANNNRYLKYSIASQPRRDGQ------TNWYNITVFNEQINFLTEYVRKGALVYVEADAANYVFERDDGSLSLVQKDINLLKNGKKLEDAEG 111
25 -41.6002ihf_A mol:protein length:239 Single-stranded DNA-binding protein  ali model follow..  13  112..RETLEDARGQPRLRRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERRR--GQEEERTHFLEVQAWRELAE-WASELAKGDGLLVIGRLVNDSWTSSSGETRVEALRLERPLEDFPPEED.. 236
26 -40.6003lgj_A mol:protein length:169 Single-stranded DNA-binding protein  ali model follow..  16  4.....GTLEAQTQGPGSMLNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFESYMNTHQKVEKTEWHSVVVFNPFAKIALQYLHKGSKVYIEGKLQTRKWQDKNGHTEIVLPQLHLLDAKKEQSASSS 137
27 -39.8004gs3_A mol:protein length:107 Single-stranded DNA-binding protein  ali model follow..  19  5............AGNFLENNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKD-------YLPITISNRLFEGM--NLEVGTRVKIEGQLRSYNRKSPEEILTVFARDISVVPE......... 107
28 -39.4003pgz_A mol:protein length:193 Single-stranded DNA-binding protein  ali model follow..  12  1MAMGTLEAQTQGPGSMASLNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRNTNERKERTEWHNIVIFNELVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNTEIVLQKLQMLDGRAAAGGEQM 140
29 -39.4002hql_A mol:protein length:110 Hypothetical protein MG376 homolog  ali model follow..  11  7.................MLNRVFLEGEIESSC----WSVKKTGFLVTIKQMRFFGE----RLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERSEIWKTTIEIVKIFNPKNEIVIDYKE. 109
30 -38.2001se8_A mol:protein length:301 Single-strand binding protein  ali model follow..  14  4.................GMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVINDGRERNLPWYHRVSILGKPAEWQARNLKGGDAVVVEGTLEYRQWEAPEGGVNVKALRMEQLGTQPELIQDAG 120
31 -37.2001x3e_A mol:protein length:165 Single-strand binding protein  ali model follow..  12  1...............MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEVEVEVDEIGPSLRYATAK.... 116
32 -37.1001ue1_A mol:protein length:164 Single-strand binding protein  ali model follow..  11  1...............MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEIEVEVDEIGPSLRYATAKVNK. 119
33 -36.1003afp_A mol:protein length:168 Single-stranded DNA-binding protein  ali model follow..  11  1...............MAGDTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEGEALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEVEVEVDEIGPSLRYATAK.... 116
34 -32.9003eiv_A mol:protein length:199 Single-stranded DNA-binding protein 2  ali model follow..  12  1...............MAGETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPRTFDRQTNEGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSYEDREGVYELDVDEVGASLRSATAK.... 116
35 -32.2004dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model follow..  14  2.................AGSNALMIGRIADVQH--GFLGAMTVTQYVLEVDG----GASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGY...... 100
36 -31.7003k7u_C mol:protein length:148 MP18 RNA editing complex protein  ali model follow..  13  1.............GMSKSVNSVTLVGVV-HDIQSGFV-YEDAVTQFTLTTTSIDHPTQEVVVEKDHHTIRCFGEFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNVQPPHGQVAVIHGDRRTVPAAV 125
37 -31.2003k81_C mol:protein length:164 MP18 RNA editing complex protein  ali model follow..  13  4LTSRRLLLQQTFMRCCKSVNSVTLVGVV-HDIQSGFV-YEDAVTQFTLTTTSIDHPTQEVVVEKDHHTIRCFGEFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNVQPPHGQVAVIHGDRRTVPAAV 141
38 -30.8004dam_A mol:protein length:128 Single-stranded DNA-binding protein 1  ali model follow..  17  2...........RGSGSMNEIMICAVGNVATTPVFRDLANG-PSVRFRLAVTARYWDREKNAGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVRERTSADIDAVAI.............. 109
39 -30.1003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  13  27.VAPNAPEEGEVAAHWRCVNHCVMLGVV-QNIQEGFV-FEDKVLQFTLITDFEGPSPGDPDKD--FHTVRVFDDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGS...... 144
40 -29.7005gqo_A mol:protein length:190 Single-stranded DNA-binding protein  ali model follow..  12  1MGSSSSGLVPRGSHMNMFETPFTVVGNIITNPV-RLRFGDQELYKFRVASNSRRRSPEGTPGNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYEDREGVVEVRATAV.............. 119
41 -28.7002wkc_A mol:protein length:119 ORF34P2  ali model follow..  10  2.........................................TIITVTAQANEKNTAKGDKKIIKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYPTVEKVFITNDNSSQSQAKQD. 102
42 -28.0002wkd_A mol:protein length:119 ORF34P2  ali model follow..  11  2.........................................TIITVTAQANEKNTRTSTAKGDKKIISVPLFEKEKGSNVDFIQMGDTVTVSGRVQAKESGEYVNYPTVEKVFITNDNSSQSQAKQD. 102
43 -27.2004dni_A mol:protein length:257 Fusion protein of RNA-editing complex proteins MP42 and MP18  ali model follow..  12  13.VAPNAPEEGEVAAHWRCVNHCVMLGVV-QNIQEGFV-FEDKVLQFTLITDFEGP--SPGDPDKDFHTVRVFDSYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMR...................... 114
44 -10.6004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  14  36..................IKQVDVLGTVIGVRERDGVDDSTGVINCICLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRT------REEREIHATTYYKVDDPVWNIQ... 145
45 -9.6304gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  19...................SEVVVAGWVAHLGDY----GRVKIVKV--------SDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKP...... 109
46 -9.2604glv_B mol:protein length:107 OBody AM3L09  ali model follow..  19...................SEVVVAGWVAHLGDY----GRVKIVKV--------SDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA........ 107
47 -9.2504gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  20...................SEVVVAGWVAHLGDY----GRVKIVKV--------SDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA........ 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.