current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v7o_A mol:protein length:165 alanyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLELast
1 -104.0001v7o_A mol:protein length:165 alanyl-tRNA synthetase  ali model  100  1MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLE 159
2 -95.4003rhu_A mol:protein length:160 SC_1wnu  ali model follow..  90  2.YSIEVRTHSALHVVKGAVVKTAGSDAKWTTSTYVKGNKGVLIVKAALEPDKWGIAAIEALANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELE..... 154
3 -93.9003rfn_A mol:protein length:159 BB_1wnu_001  ali model follow..  88  1.YSIEVRTHSALHVVKGAVVKAAGSAAKWTTSTYVKGNKGVLIVKAALELDKWAWAAMEALANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELE..... 153
4 -60.2003kew_A mol:protein length:241 DHHA1 domain protein  ali model follow..  21  91.RFDGMQQHLGQHLLSGCFYDLFGANTC---GFHLGKEISTVDIV--GFLDEKTIREAEKEANRLIFENLEVKSYAPSKKELKKVKTRRAL-----PKTDEEIRIVEIVGLDLNACCGVHPRNTRDLQVIKIRRWE--KHKNATRIEYVAGNRAVSE.. 234
5 -58.9002zze_A mol:protein length:752 Alanyl-tRNA synthetase  ali model follow..  36  606.RIQHMRHHTGTHVLMGALVRVLGRHVWQAGS-QLTTDWARLDISHYKRISEEELKEIEMLANRIVMEDRKVTWEWLPRTTAEQKYGFRLYQGG--VVPGREIRVVKIEDWDVQACGGTHLPSTGLVGPIKILR-TERIQDGVERIIFACGE....... 752
6 -57.1002e1b_A mol:protein length:216 216aa long hypothetical alanyl-tRNA synthetase  ali model follow..  24  92.RYKLMRIHTGLHLLEHVLNEVLGEGNWQLVGSGMSVEKGRYDIAYPENLN-KYKEQIISLFNKYVDEGGEVKI-----------------------WWEGDRRYTQIRDFEVIPCGGTHVKDIKEIGHIKKLKRS-SIGRGKQRLEMWL......... 215
7 -51.9003wqy_A mol:protein length:906 Alanine--tRNA ligase  ali model follow..  35  593.RWRHMRHHSATHVLLYSLQKVLGNHVWQAGA-RKEFSKARLDVTHFRRPSEEEIKEIEMLANREILANKPIKWEWMDRIEAERKFGFRLYQGG--VPPGRKIRVVQV-GDDVQACGGTHCRSTGEIGMLKILK-VESIQDGVIRFEFAAGEAAIEAVE 745
8 -25.3004v1a_c mol:protein length:334 MITORIBOSOMAL PROTEIN ML39, MRPL39  ali model follow..  12  141........RSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYD-MPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASIVKLHRFGDF-IDVSEGPLIPRTSICFQYEVSAVHNLQTQSVRRFQGLSLPVHLR... 303
9 -20.7003j7y_7 mol:protein length:338 mL39  ali model follow..  13  144........RSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASIVKLHRIGDF-IDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVS...... 301
10 -19.4001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  17  73........HSCAHLLGHAIKQLWPHTKMAIGPVI--DNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANKVSILDENIAHDDKPGLYFHEEY-VDMCRGPHVPNMRFCHHFKLMKTAGAYWRG................. 208
11 -16.5001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  20  75........HSTAHLMAHAIKRLYGNVKFGVGPVI--EGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVSRDEAKELFSNDEYKLELIDAIPENVTLYSQGDF-TDLCRGVHVPSTAKIKEFKLLSTAGAYWRG................. 207

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.