current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v95_A mol:protein length:130 Nuclear receptor coactivator 5, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQASGPSSGLast
1 -60.6001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model  100  1GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQASGPSSG 130
2 -28.5001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  538......APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNE--KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRG--KDLGSMDVNEVIEKLQQEIRSRSLKQLEE............... 642
3 -27.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  303......SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADID-LDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNK--VHGERTISETIERLQQLKEFRSKQAEEE............... 408
4 -27.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  299......SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADID-LDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNK--VHGERTISETIERLQQLKEFRSKQAEEE............... 404
5 -26.7004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  12  299......APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNE--KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGK--DLGSMDVNEVIEKLQQEIRSRSLKQLEE............... 403
6 -25.7001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  544......APKQVQIIPVNVDHYDYARQLQDELKSQGVRVSIDDRNE--KMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGS--QDQETVEKDEFIWNLVDEIRLKKHR................... 645
7 -24.5003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  18  337......APIQFAVIAVKTEIEDLASSIAKGLLDKGFRVAVKG-SSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLE--SMKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSGQAP... 461
8 -23.4003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  10  338......NPYQAVIIPVNTKNVQQLDMCTAPLNDWHFNVDLDIRNE--PVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNR-KSFEKLTMSQIWEKFIELEKNY...................... 453
9 -22.2001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  307......AAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLD--DRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTG--EKVTADLQGIEETLRELMKDILENLRTRAWE............ 419
10 -22.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  286......APIQVVIVPIRERVLEAAQGLRQALLAQGLRVHLD--RDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALA............... 398
11 -22.0002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  66....RTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLY-KKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEV--DVRREDLVEEIKRRTGQ....................... 165
12 -21.5002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  358......APFRVTILNLDAATDAACDQLYRELSAKGVDVLYD--DTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDG--ARENLALADVVARLT............................ 452
13 -21.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  18  292......APIHVVIIPIGCGKKNNQESADTLKSKLGLRVSID--DFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKRVIPITEVMKVSSHTTENHELVVKNV............... 410
14 -21.4005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  14  294......APVQVIIIPITEEQKKICNEVECILKKAGVRVKID--RSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNM--EKMDIPISELESKIPKLLEEFQNRLLFKAKQ............ 408
15 -21.1005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  289......ASTQVIIIPVGQELLASCWRLESELCEGGVRARCD--RDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSG--ARHSVAWDAQTPAAVAALLEDVHAQMYARAKE........... 408
16 -21.1004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  291.......KYKVVIVPIFYKTTSYCKDIEKILKNAQINCVYD--RASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNN--EKCNVKKESVLLETQQMLVDIHKNLFLKAKK............ 404
17 -20.5005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  10  287.......SVQVVIIPITGEILGKCRELKTMLEKADIRVRID--RSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTG--EAYQISWADLAPKLLELMEGIQRSLFEKAKA............ 400
18 -20.5004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  318.......CVQVVIIPCKEALIAKCNDYRRRLLSVNIRVRAD--RDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTG--EKLTVAENEAETKLQAILEDIQVTLFTRASE............ 435
19 -20.1004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  302.......CVQVVIIPCKEALIAKCNDYRRRLLSVNIRVRAD--RDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTG--EKLTVAENEAETKLQAILEDIQVTLFTRASE............ 419
20 -20.0001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  17  335.......PIKVAVIPLVKNRTEYAKRLKARLLALGLGRVLY--EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDTVTVRDRDTMEQIRLHVDELEGFLRERLR........................ 441
21 -19.7005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  17  288.......AVQAVIIPIIFKETGKCRELERLLNAAGVRVKVD--RTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTS--EARNVPWAEAASTIPAMLETMQKDLFNKAKA............ 401
22 -19.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  412EEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNP-KLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEV--DVRREDLVEEIKRRTGQPL..................... 517
23 -18.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  359EEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNP-KLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEV--DVRREDLVEEIKRRTGQPL..................... 464
24 -18.1001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  12  282.......PIQVVIVPLIFKGKEKAKEIYEKLKG-KFRVHID--DRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTM--EKFQVDETQLMEVVEKTLNNIMENIKNRAWE............ 392
25 -17.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  20  329....PREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERG--LSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQE--NVGLDSVVEHLISQATL....................... 427
26 -17.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  365.NTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNF--EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQV--EVALADLAEEIKRRLT........................ 465
27 -17.4003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  351...DIPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKK--VVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGK--EEGGAERGFAVPLD.......................... 447
28 -17.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  18  351...ELHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKK--VVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGR--EEGANERGIVLPVD.......................... 447
29 -17.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  16  344...PEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLRGTGDVQQSVPVESLTEFLINAMVATAEDGDD................ 461
30 -16.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  10  329....EIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQS--QVALAELVPFLIEKFTK....................... 432
31 -16.6001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  17  325...DIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDY--LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESE--TIELDALVEYFKK........................... 420
32 -16.1001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  17  398.......PIKVAVIPLVKNRTEYAKRLKARLLALGLGRVLY--EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSK-TVTVRDRDTMEQIRLHVDELEGFLRERLR........................ 504
33 -15.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  331...KADPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQT--AVAQDSVAAHLRTLLG........................ 431
34 -15.5005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  16  473.......PFQIALVPLTESVKQATDKLYAELTAAGFEVLLDDRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQ--NLPIGELMSFITEKLSR....................... 573
35 -15.2005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  380.......PIKVALDVGTLELRQVCQGLFNELLENGISV--YLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE--MMHISKLKDFLIKYISSA...................... 482
36 -14.7004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  13  356.......PIKVALDVGTLELRQVCQGLFNELLENGISV-GYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE--MMHISKLKDFLIKYISSAKN.................... 460
37 -14.6002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  12  363.......PIKVALDVGTLELRQVCQGLFNELLENGISVPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE--MMHISKLKDFLIKYISS....................... 464
38 -14.6001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  12  338.......PIKVALDVGTVELRQVCQGLLNELLENGISV-GYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKE--MMHISKLRDFLVKYLASASN.................... 442
39 -14.6003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  13  348.......PIKVALDVGTLELRQVCQGLFNELLENGISV-GYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE--MMHISKLKDFLIKYISSAKN.................... 452
40 -14.4002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  11  559.......PFKCSVLPLNQEFMPFVKELSEALTRHGVSHKVD--DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNIT.................... 661
41 -14.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  11  326...PEEKGPDLYLIPLTEEAVAEAFYLAEALRP-RLRAEYAL--APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQV--RLSREEVPGYLLQALG........................ 423
42 -14.2005c53_B mol:protein length:903 Pol gamma B  ali model follow..  13  347.......PIKVALDVGRGPTLELCQGLFNELLENGISV-GYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE--MMHISKLKDFLIKYISS....................... 448
43 -13.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  10  470.......PFDLHVVQMDEYQTKLSQEVEAMMTEAGY--EVLVDDRNERAGVKFADADLIGCPIRITVGKKAVDG---VVEVKIKRTGEMLEVRKEELESTLSILMNTTSEVE.................. 572
44 -9.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  328NGEIISNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGV--TDVDAMSSNYQDVIYCIGTAGRGGEDA....................................................... 400

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.