current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1wu7_A mol:protein length:434 Histidyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MYRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLELast
1 -132.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model  100  1MYRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLE 428
2 -115.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  35  18KNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSKDVGIKVNSRKVLQTVVEGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLS-LKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGRYDNLLTTYGSPPIPCAGFGFGDCVIVELLQEKRLLPDPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPLD.... 447
3 -114.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  35  18MNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSDVGVKINSRKILQTVVEGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSL-KTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDVIFDASVVRGLAYYTGIVFEGFDRDGNFRALCGGGRYDNLLTTYGSPTVPCVGFGFGDCVIVELLNEKKLLPEHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPVD.... 447
4 -109.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  25  1MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDAVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGET---------DERTEYRNALVAFLNEHKDALDED-SQRRLTTNPLRILDSKIESTQKILENAPHDFLKEDSLSHFQQLQDYLTAAGIK-FVINQKLVRGLDYYNKTVFEWTTTAGSQGTVCAGGRYDGLVGQLKGKSVPAVGFAMGMERLLLLLEQVEQAEI-VRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK. 432
5 -109.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  27  2.....IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKH-LKLVINSVGDM---------ASRKEYNEALVKHFEPVIHEFCSD-CQSRLHTDPMRILDCKVDRDKEAIKTAPTDFLNEESKAYYEQVKAYLDDLGIP-YTEDPNLVRGLDYYTHTAFELMMDNGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK..... 420
6 -105.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  25  1.GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAAVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRR-LKVKLSSVGDP---------EDRARYNAYLREVLSPHREALSED-SKERLELNPMRILDSKSERDQALLKELGLDFLGEEARAHLKEVERHLERLSVP-YELEPALVRGLDYYVRTAFEVHHEEGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEKGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG.. 423
7 -104.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  24  7NDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGD-FVIRINNRKVLTGFFQNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDFCIDLAIARGLNYYTGTVYETTLIGEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT.. 465
8 -103.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  25  9..AKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSL---------EARANYRDALVAFLEQHKEKLDED-CKRRMYTNPLRVLDSKNPEVQALLNDAPGDYLDEESREHFAGLCKLLESAGIA-YTVNQRLVRGLDYYNRTVFEWVTNSGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKDPVVDIYLVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG.. 431
9 -102.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  24  62KQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGED-SKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK--LTNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGKGLAPEVADRIGDYVQQHGGVSLVEQLNKQALEGLGDLKLLFEYLTLFGIDDISFDLSLARGLDYYTGVIYEAVLLQLGVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALETTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQP 516
10 -101.0004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  24  10.RQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGED-SKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK--LTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGKGLAPEVADRIGDYVQQHGGVSLVEQLNKQALEGLGDLKLLFEYLTLFGIDDISFDLSLARGLDYYTGVIYEAVLLQLGVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALETTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQP 463
11 -97.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  26  22.KLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVVEKEMYSFVDANGENLTLRPENTAAVVRAAIEHNLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTG-IKLEINSLGLA---------EERAAHRVELIKYLEQHADKLDDDAQR-RLYTNPLRVLDTKNPALQEIVRNAPIDFLGDVSRAHFEGLQRLLKANNVP-FTINPRLVRGLDYYNLTVFEWVTDKGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMVAT 455
12 -91.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  25  6.KPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV-GVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSE-FKVAIGHVGYVNALLMVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLTEKGKTALAEMTKLYEVLESYGASEVKFDLTLVLHMSYYTGVVFEGYGNRLG-VPLCSGGRYDELLSKFHR-PAQATGFGVRIDLLVEALNGEII---SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA............................... 400
13 -82.8003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  20  18AVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVVDMDVLRLLHEASAAAGVRH-HRIVVSHARLVPRLLDGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLDVVTFDLALHRELDYYTGLVFEMFAP-GVGAPIAQGGRYDELLAQFGA-GAPAVGFAFEVERVMAVLEAQEEGEGEC................................................................................................. 373
14 -82.5006FTT Entity 1(prereleased)  ali follow..  18  4........PDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG-DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAEALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIVFNGYIN-SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPF-IVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV......................................... 388
15 -82.5005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  18  4........PDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG-DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAEALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIVFNGYIN-SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPF-IVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV......................................... 388
16 -73.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  20  11MEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD-STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNK-TVFEIGSAKFFQRLCQ-LADGSTELLTELLLKKDLSGLNAFIEKNNF----SKELRGLLKEIFITNELSRLENLNTKDDVLISSFDQLKEFSEKLSMKPIIIDLGMVPKMDYYTDLMFKAYSS-AANQPILSGGRYDQLLSNFQE-EAFAIGFCCHMDTILKALERQELEEDND................................................................................................. 338
17 -63.8001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  15  2.............DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP----------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSP-DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGP-VIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPL----SVREDLLSASSFLQEKFPTSVEIDLTLARTIEEYCGLIFTIYDT-SSSRLVAAGGEYTVNGE-------KGVGGSIFLEGK............................................................................................................... 273
18 -48.1002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  3......................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIELGPDESKQKFVLKTPKALEEKRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQP 166
19 -45.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  34ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVDKNFCLRPMLAPNLANYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHG--LELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSE....................................................................................................................................................................................................... 258
20 -42.3004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  51ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIE-RMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDDLELSSAVVGPRPLDREWGIDKPWIGAGFG----------------------LERLLKVKHDFKNIKRAARSESYYNGISTN............................................................................................................................................................................. 284
21 -42.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  14  48ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLL----------------------KVKHDFKNIKRAARSESYYNGISTN............................................................................................................................................................................. 281
22 -39.7005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  13  34ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLE--SIITDFLNHLGIDF--KIVGDSCMVYGDTLDVMHG--LELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAAR......................................................................................................................................................................................................... 256
23 -37.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  14  52.SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYI-ERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGID--FKIVGDSCMVYGDTLDVMHGDLELS-SAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRA........................................................................................................................................................................................................... 271
24 -36.8004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  33ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIE-RMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGID--FKIVGDSCSVYGDTLDVMHGDLELS--AVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAAR......................................................................................................................................................................................................... 255
25 -32.9004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  14  52.SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYI-ERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVLELSSAVVGPIPLDGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL............................................................................................................................................................................................................................. 285
26 -30.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  13  63IEHQLMSQGKRHLEQLVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGE-DHPLFSQVFWLDGKKCLRPMLAPNLYTLWREERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIRE-FELVTESSVVYGDTVD............................................................................................................................................................................................................................................................... 236
27 -29.2002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  17  48......QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRES--DAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARNKMFVAYLRTFARMGL-KAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTR------------IEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGG-------------------YGVGVSRLLGAIIEACHDDNGAPFRVTILNLKAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT...... 452
28 -27.1002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  34......QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESG-ETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDNSYKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLE-ANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIE--IGHIFKL------------GTRYSDAMGA-GREKSVIMGYGIGVSRLLSAIDERGINWPTGIAPFDLHVVDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMNT. 567
29 -24.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  13  55...IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEK-VADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLA---------------------------------------------------------------------IPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED. 424
30 -24.6005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  14  36......RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQES--EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNNSYKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPLPEVADLRNVVEGDPSPDGKGTLVIKRGIE--VGHIFQL------------GTKYSEAMKL-GKPVNLIMGYGIGVSRVVAAADERGILWPSALAPFQIALVTESVKQATDKLYAELTAAGFEVLLD-KKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR. 573
31 -24.4005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  11  26...IEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDEGFSPEVAWVTHYGDSPIAIRPTSETIMYPAYAKRSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELILELYRRWYEECLA---------------------------------------------------------------------VPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQT-------------------WGCTTRSLGVMIMTHGIPPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRID-SNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEG. 389
32 -24.2004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  13  30...IEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNEGFSPEVAWVTKYGDSEIAIRPTSETIMYSVFPKRSYRDLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGG-----------------------------------------------------------------ANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQT-------------------WGCTTRSIGIMIMTHGLPPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYD-ASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVD. 393
33 -24.2004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  39...IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTVADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLA---------------------------------------------------------------------IPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED. 408
34 -24.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  27...VEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDEGFKPEVAWVTHYGDSELAIRPTSETIMYPAYAKRSHRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAV--------------------------------------------------------------------PVIKGEKSENEKFAGGKKTTTIEGIIPDTG-RGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQT-------------------WGCTTRSLGVMIMTHGLPPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVD-TNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLET. 390
35 -23.4005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  34...IEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDEGFSPEVAWVTKSGKSDIAIRPTSETIMYPYFAKRSHRDLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEALEMVDII-------LNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAV-----------------------------------------------------------QAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTGLTTRAIGVMIMTHGDNKGLVL---------------PKVAPVQVIIIPIIEEQKKICNEVECILKKAGVRVKID-SNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEE. 397
36 -23.1001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  15  52......YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIKGFEDEVYWVTSKLQRKLALRPTSETVMYPMFALRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIPYLITRR-----------------------------------------------------------------PPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFE----IKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCL---------------PDVAAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKD. 408
37 -23.1004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  26.........PGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGD-----------------IEVWDQAEKQLENSLNEFGEK------------------ELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPINLTYVSHDGDDKKRPVIVHRAILGS-RMIAILTENYGGKWP------------------------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFR 401
38 -22.9003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  12  36......YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDKGFEAECFWVEQPLEERLALRPTSETAIYSMFSKRSYKDLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQLSDYW-----------------------------------KVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQT---------------------------GIHNLGQRFSSTFD----ILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVL---------------PLIAPIHVVIIPIGCGKKNNQESADTLKSKLGLRVSID-FSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSHTTENH 403
39 -22.9004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  22.........PGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGD-----------------IEVWDQAEKQLENSLNEFGEK------------------ELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPINLTYVSHDGDDKKRPVIVHRAILGS-RMIAILTENYGGKWP------------------------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFR 397
40 -22.8001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  14  25......YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLKVHTDLPIKIYQIVNTFRYEKHTRPRLREIMTFEAHTAHSTKEEAENQAISIYKKFFDTLGIP---------------------------------------------------------------------YLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASI----------------IAIHGDEKGLILPPIVAPIQVVIVKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNN. 381
41 -22.8005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  11  27...IEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDEGFAPEVAWVTRAGDTEVAVRPTSETVMYPYYAKRSHRDLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEVLEI-------LECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQG------------------------------------------------------TSHNLGQNFGKMFD------IRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCD-DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLED 397
42 -22.3004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  16  22.........PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEK-IVVKLSTRP--------------------------------EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSAYVGEDNERKVPVMIHRAILGS-RFIGILTEEFAGFFP------------------------APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSR 396
43 -22.3001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  26.ELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEEGFSPELAVVTHAGEEPLAVRPTSETVIGYMWSKRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEVRRM-------LSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEAL------------------------------------------------------MKDGKALQAGTSHYLGENFARAFD----IKFQDRDLQVKYVHTTSWGLSWRFIGAI----------------IMTHGDDRGLVLPPRLAPIQVVIVRERVLEAAQGLRQALLAQGLRVHLD-DQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLAS-RLGGKETLPLAALPEALPGKLDA. 387
44 -21.5001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  10  29.........QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS--NMMFQDLRGPRGGRGLLAYLRPETAQGIFKNVLDATSRKLGFGIAQIGKAFRNEITPR-RVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE-NLVPYQQP---------PESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVL---------------------ALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI----------------LVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.. 441
45 -21.2001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  14  261.........AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS--DHYQEDMFPPMLDETESMVLRPMNCPHHMMIYANHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFED-YSFRLS-----------YRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIKLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEET-----------KGAFPTWLA---------------------------------PKQVQIIPVNVDLYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLK 642
46 -20.5003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  39.........AGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNESKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDYDVFEEMKLVLERLFKLGVSSETFK--------------------VRLSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFIMMVEESGVSMGTIQFDFNLPRRLYDVVREEFGIEEVYIIHRALLGS-RFLGVYLEHRRGRMP------------------------APIQFAVIAVKTGGEDLASSIAKGLLDKGFRVAVKGSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENL 442
47 -19.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  16  258......EEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEK-IVVKLSTRP--------------------------------EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSAYVGEDNERKVPVMIHRAILGS-RFIGILTEEFAGFFP------------------------APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSR 635
48 -18.3003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  45......PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS--ENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFV-KGGSGAESNY------FINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSN-----------EGRWPFWLN----------------PYQAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEKNY 453
49 -18.0001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  11  107PEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPR-NMMFQDLRGPRGGRGLLAYLRPETAQGIFKNVLDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE---NLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIE--PSAGVDRGVLALLAEAFTREELPNGEE------------------------------------------IVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.. 504
50 -17.8001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  20  5........................................................................................................................................................................................................................................................................................................................................SSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTELSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYER. 107
51 -14.5002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  15  90........VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSKKSEMESVLAQLDNYGQQELALRPETAQGIFKRLLEFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVS-SARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGLTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDEQVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGN 659
52 -13.3003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13  15...................IDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMLTHSMILHKQLAIAMGLE-------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGL------------RKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLK--------EDSFRPYLEIA-----------------RA--------GKLKPSAGAGIGVERLVRFI........................................................................................................... 272
53 -13.3001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  12  15...................LDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMLTHSMILHKQLAIAMGLK-------KIFVLSPNIRLESRQKDDGREFTQLDFEVERAK------DIMRLIERLVYGL------------RKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLN--------EDSFRPYLEI------------------KA--------GKLKPSAGAGIGVERLVRFI........................................................................................................... 272
54 -13.2003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  15.................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-TVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG-----PVFQLCRSFRNEEMGRHHNPEFTMLEWDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPA-----------SQASLAQISTEDHRVAERFEVYYKGIE------------LANGFHELTDAREQQQRFEQDNRKRAARGL-QNLLDALAAGLPDCSGVALGVDRLVMLALGAE....................................................................................................... 313
55 -13.2002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  10  77.........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDSAFRLEQLVTFLENVLKTSGKLRENLLHGALVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPS----------------------------SSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDH--ELLHMYPGNVSKLHGRDGRKNVVPCV-------LSVNGDLDRGM---LAYLYDSFQLTENSFTRKKNLH--------------------------KVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA 465
56 -13.1004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  71..........CHPGFGPLGVELRKNLAAEWEQVFPVDALHHKPGPLLPGDSAFRLVSAETLREIL-FLENVLKTSGKLRENLLHGALVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPS----------------------------SSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDH--ELLHMYPGNVSKLHGRDGRKNVVPCV-------LSVNGDLDRGM---LAYLYDSFQLTENSFTRKKNLH--------------------------KVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA 458
57 -13.1005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  94.........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDSAFRKEQLVAFLENVLKTSGKLRENLLHGAYVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPS----------------------------SSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDH--ELLHMYPGNVSKLHGRDGRKNVVPCV-------LSVNGDLDRGM---LAYLYDSFQLTENSFTRKKNLH--------------------------KVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA 482
58 -12.8003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  28.................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-TVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG-----PVFQLCRSFRNEEMGRYHNPEFTMLEWDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPA-----------SQASLAQISTEDHRVAERFEVYYKGIE------------LANGFHELTDAREQQQRFEQDNRKRAARGL-QNLIEALKVGMPDCSGVALGVDRLVMLALGAE....................................................................................................... 326
59 -12.0001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  11  56.............RFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRQLVAFLENLLKTSGKLRATLLHGALVNCLDLVNRKLPFGLAQIGVCFHPVSNSN-RVGEKTEASLVWF--------------------------------------------TPTRTSSQWLDFWLRHRLLWWRKF-------AMSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLG-----------LAYLYDSFQLAENSFARKKSLQRKVLKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWPGYVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASA 440
60 -11.6005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  10  164...................LKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQV-------EGGATLFKLDYFGEEALTQSSQLYLETCLPALG--------DVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLT------DLLNRLEDLVCDV------------DRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPV----IKSFYMQRCPEDSRLTESVDVLMPNVGE----------IVGGSMYYWYTDQRKYGTCPHGGYGLGLERFLTWI........................................................................................................... 445
61 -11.6003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  66..........................SEALLEICQRRHFLSGSKQQLSRDSLLSGPLGVELRKNLAA-PGDSAFRGGLRENLLHGALVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPS----------------------------SSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDH--ELLHMYPGNVSKLHGRDGRKNVVPCV-------LSVNGDLDRGM---LAYLYDSFQLTENSFTRKKNLH--------------------------KVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA 450
62 -11.5004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  210...................FRLQSGICHLFRETLINKGFVEIQTPKII-------SAASEGGANVFTV-SYFKNNAYLAQSPQLYKQMCICAD-------KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYHYHEVMEEIDTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPL---------AVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQ-RIHDPQLLTERALHHGKIKAYIDSFRFGAPPHAGGGIGLERVTMLF........................................................................................................... 494
63 -11.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  10  226.TRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSS-------EGGSNIFEV-KYFDRKAYLAQSPQLYKQMAIMGD-------KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVENYH---ECIDVMEKLFTFIEIPKRFPDELKVIRKQYPFEDLIYRPLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPA---------AIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQ-RIHDPEFLMKRCIEKGTLKDYIESFRFGSWPHAGCGIGLERITMLY........................................................................................................... 527
64 -11.1001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  181...................FRIQAGVCELFREYLATKKFTEVHTPKLLGAP---SEGGSSVFEVTY------KGKAYLAQSPQFNKQQLIVAD-------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYH---EVLDTLSELFVFIELPKRFAHEIELVR--------KQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSFMRGEEILSGAQ-RIHDHALLQERMKAHGGLKDYCDGFSYGCPPHAGGGIGLERVVMFY........................................................................................................... 469
65 -11.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  11  127..RLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL------TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQMLMVAGLD---RYFQIARCFRDEDLRADRQPDFTQLDLEM----SFVEVEDVLELNERLMAHV--------RLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLTSPHPEDLPLLEKDPGRVRALAYDL---VLNGVEVGGGSIFRLLGIGEEEQR----EKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGS-----PSIREVIAFPKNKEGKDPLTGAPSPVPEEQLR................................................................... 571
66 -10.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  135...................MKVKETLIMAAREWLLKDGWHEVFPPILV-------TGAVEGGATLFKL-KYFDKYAYLSQSAQLYLEAAIFGLE------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYMRTLELRKKEIEMFRDDLTTLKNTEPPPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVL-------------ASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGDYEWYLDLRRYGSVPHSGFGLGVERLVAWV........................................................................................................... 413
67 -10.9003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  156...................LQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQC-------EGGSTLFKLQYFNEPALTQSSQLYLESVIASLG--------KSFCMLSSYRAEQSRTVRHAEYLHLEAELPFIS------DLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSK----------------MKAFYMSKVPGHPDLTESVDLLMPGVGE----------IVGGSMYYWYTQQRKYGSCPHGGYGLGVERLVMWL........................................................................................................... 435
68 -10.9002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  10  134...................LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQV-------EGGSTLFNL-DYFGEQSFLTQSSQLYLETCIPTLG------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFIT------DLMEKIEELVCDTRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAE--------AAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEPYYWYLDQRLYGTCPHGGYGLGLERFICWL........................................................................................................... 416
69 -10.9001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  12  137...................FKIRSSVFKAVRDFFHENGFIEIHTPKIIATAT-------EGGTELFPM-KYFEEDAFLAESPQLYKEIMMASG-------RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIEDEE---EVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPS---------EAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQ-REHRHDILVEQIKEKGSFEFYLKAFRYGMPPHGGFGLGAERLIKQM........................................................................................................... 417
70 -10.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  4.........DGYSSYVLLQEQILTVKRSFSEALEKELNLVEVRAPILFRVGDGTQDNLSGFEKAVVPVKAIPNASFEVVHSLAK-WKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIKTELAVCEKYKQKPILPETIQFVHAEHLLLAYPNLREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSLEVSSMGI-EALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKK....................................................................................................... 330
71 -10.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  12  136..RLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL------TRSTPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGM-----RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVEADDVIAISEQVLKAVTIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGAMHHAFTAYDIVCNGNEI----GGGKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGV-----DSIREVIAFPKSGGGVDPLTDAPAPITPQQRK-ESGIDAKPREDKPKEDAKSKA............................................. 614
72 -10.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  120..RLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL------TRSTPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGM-----RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVEADDVIAISEQVLKAVTIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPG---FTSDAYDIVCNGNEI----GGGKFGFLLDAFSYGAPPHGGIAFGWDRITALLAG-----VDSIREVIAFPKSGGGVDPLTDAPQQRKESGIDAKPREDKPKEDAKSKAAAA................................................ 601
73 -10.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  11  179.................KVARQRIAVMRAIRSALERRGFLEVETPMLQTL------AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFE-----RVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDD-EDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSI...................................................................................................... 490
74 -10.4005c53_B mol:protein length:903 Pol gamma B  ali model follow..  10  518..........................SEALLEICQRRHFLSGSKQQLSRDSLLSGPLGVELRKNLAA-LLPGDSAFRLRENLLHGALVNCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPS----------------------------SSSDCQDEEGRKGNKLYYNFPWGKELIETLWNL--GDHELLHMYPGNVSKLHGRDGRKNVVPCV-------LSVNGDLDRGM---LAYLYDSFQLTENSFTRKKNLH--------------------------KVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA 900
75 -10.4005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  11  139..RLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI------TRSTPEGARDFLVPARLHPGSFYAL-PQSPQLFKQLLMVAGM-----RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVDAEDIIAISEEVLTELLIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPG----LADAYDIVCNGHEI----GGGKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGM-----DSIREVIAFPKTGGGVDPLTDAPAPITAQQRK................................................................... 596

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.