current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MRGSGSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQELEEDNDLast
1 -112.0001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model  100  1MRGSGSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQELEEDND 338
2 -88.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  22  1......SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV----GVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMGNEQRADRLRRFLYEKNYVGYREHVKSLNLSSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLCSGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHE 337
3 -86.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  20  8RSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS---RDWIRLFDGGGDAVALRPEMTPSIARMAAPRAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEAVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDISASLSRAFLACLTSGNYVQFRELWQLHAAKDKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLSDVVTFDLALHRELDYYTGLVFEMFAPGVGAPIAQGGRYDELLAQFGAGAPAVGFAFEVERVMAVLEAQEEGEGE. 372
4 -84.6006FTT Entity 1(prereleased)  ali follow..  21  2................MLPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQNQPRQATGFSMDVSRLLAHTQLDAPFIVL. 328
5 -84.6005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  21  2................MLPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQNQPRQATGFSMDVSRLLAHTQLDAPFIVL. 328
6 -80.7001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  15  2.......................DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP-------------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPDSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEH--LKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVAAGGEYTVNGE------KGVGGSIFLEGKT............. 274
7 -79.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  21  12.GPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDALNENLTLRPENTAAVVRAAIEHNYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADK-----LDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNV--PFTINPRLVRGLDYYNLTVFEWVTDGAQGTVAAGGRYDPLIEQLGGPTAACGWAMGIERILELLKEEHLVPEQE 347
8 -78.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  20  2.....PGYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISHVTLELNSIGSLEARANYRDALVAFLEQHKEK-----LDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGI--AYTVNQRLVRGLDYYNRTVFEWVTNGSQGTVCAGGRYDGLVEQLGGATPAVGFAMGLERLVLLVQAVNPEFKAD 333
9 -78.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  23  2...............IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHE-----FCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGI--PYTEDPNLVRGLDYYTHTAFELMMDNPNTTLCGGGRYNGLLELLDGSETGIGFALSIERLLLALEEEGIELDIE 327
10 -77.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  22  1..........MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNTLGETDERTEYRNALVAFLNEHKDA-----LDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGI--KFVINQKLVRGLDYYNKTVFEWTTTGSQGTVCAGGRYDGLVGQLKGSVPAVGFAMGMERLLLLLEQVEQAEIVR 332
11 -77.6004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  19  1...........GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREA-----LSEDSKERLELNPMRILDSKSERDQALLKEVRPMLDFLGEEARAHLKEVERHLERLSV--PYELEPALVRGLDYYVRTAFEVHHEGAQSALGGGGRYDGLSELLGGRVPGVGFAFGVERVALALEAEGFGLPEE 328
12 -74.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  19  8AQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDRGKFRALCGGGRYDNLLTTYGSPIPCAGFGFGDCVIVELLQEKRLLPDIP 353
13 -74.2004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  16  52LKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTIVDKLDKVSWEEVKNEMVGEKDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPASVAAGGRYDGLVGMFDPKVPCVGLSIGVERIFSIVEQRLEALEEK 414
14 -74.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  18  9.QTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGE--EHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRGNFRALCGGGRYDNLLTTYGSPVPCVGFGFGDCVIVELLNEKKLLPELH 353
15 -73.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  20  1..........MYRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEE---LLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIGMTSSDPFSVFSIIDRYHKISREEFVDQLRSEDGVSMIADLCSGTRGIDEMARI--TGKSSEEIARMAAVEDLLASYGV-KNVRYDFSIVRGLSYYTGIVFEAYDRGQFRAILGGGRYDNLASLMSGSVPAVGFGMGDAVISLLLKRENVQIPRE 331
16 -72.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  1..GPGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTIVDKLDKVSWEEVKNEMVGEKDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPASVAAGGRYDGLVGMFDPKVPCVGLSIGVERIFSIVEQRLEALEEK 361
17 -71.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  16  1....SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIIDNLEKIGEAKVKLELEKEGINPKIIDFVKIDGSVDDVLDKLKHLSQTLPELGVSELETVITGVRNLGVDKRFCIDLAIARGLNYYTGTVYETTLIGHEASICSGGRYEELVGTFGEKMPGVGISIGLTRLISRLLKAGILNTLP 368
18 -44.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  24LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDR...................................................................................................................................... 223
19 -41.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  38LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAG---------------------FGLERLLKVKHDFKNIKRAARSESYYNGISTNL.................................................................... 282
20 -40.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  42.NSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKP............................................................................................................................... 247
21 -37.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  13  24LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDF-KIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDGLERLLKVKHDFKNIKRA..................................................................................................................... 254
22 -36.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  12  23LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDGLERLLKVKHDFKNIKRAARSESYYNGIS.......................................................................................................... 264
23 -33.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  11  41LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRA........................................................................................................ 271
24 -29.5004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  12  41LNSGKPFRELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVG...................................................................................................................................................................... 209
25 -29.2002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  53ALSRDRAFQGIEHQLMSQGKRHLEQLVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGED----HPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFL........................................................................................................................................ 254
26 -15.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  10  51...................AGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRE--SGRYDAYGPEMLRIADRHKRELLYGPEMITEIFRAYIKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGAR-KMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIE---------------------VGQIFYF-----------GTKYSNVTGPDGTDAPIH-YGVGVSRLLGAIIEACHDDN.. 349
27 -12.9002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  11  34................QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKE--SGRYETYGPNLYRLKDRNDRDYILGPETFTELIRDEINSYKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLEFRAIIGDG................................................................................................................................................................... 199
28 -12.6004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  27....................GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWM--TSGHWQHYSENMFSF-EVEKELFALKPMNCPGMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKI-----DIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADID................ 337
29 -12.4005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  15  36................RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQE--SGRWEQYGPELLRLKDRHEREFCVGPEVITDLARNELNSYKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDFRPVQADN................................................................................................................................................................... 201
30 -12.4004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  23....................GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWM--TSGHWQHYSENMFSF-EVEKELFALKPMNCPGMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKI-----DIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADID................ 333
31 -12.3003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  11  15.............................IDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRM--RLTHSMILHKQLAIAMG--------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGL--------------FRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILWEYEKIVAKIRAAGLKE---------DSFRPYLEIA-----------------------RAGKLKPSAGAGIGVERLVRFI.......... 272
32 -12.1004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  22...................PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWE--KTGHWDNYKDAMFTT-SSENREYCIKPMNCPGIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKI-----EFTLYDCLDRAWQCGTVQLDFSLPSRLS-ASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFK....... 342
33 -12.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  11  43.DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEK--EKTHVADFAPEVAWVTRSGEPIAIRPTVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKT---GGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGD-CGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFN-----HWELKGVPIRLEVGPR--VAVRRDTGEKLTVAENEAETKLQAILED........ 424
34 -12.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  10  1MAMGGDVTFSLTKTR-YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGF-EAECFWVEQPLEERLALRPTAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNT-RVREIHWNEAHCCHATAEDAVSQLSDYW..................................................................................................................................................................................... 185
35 -12.0001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  261...................AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS-GHWDHYQEDMFPPMQLDETESMVLRPMNCPHIYANKPHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYSFRLSDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKL-----DVQVKTAMGKEETLSTAQLDFLLPERFD-LTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLVNVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYK....... 588
36 -11.8001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  10  15SEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGF-SPELAVVTHAGGEPLAVRPTVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEMLSIYARLAREYAAIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDR-VVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFH-----EWELKGVPFRVELGPK-----LGGKETLPLAALPEALPGKLDAFHEELYRRALA 398
37 -11.7004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  35.........KSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADF--APEVAWVTRSGEPIAIRPTVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKT---GGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGD-CGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFN-----HWELKGVPIRLEVGPR--VAVRRDTGEKLTVAENEAETKLQAILED........ 408
38 -11.7002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  6.................................................................................................................................................................................................................................................................................................LEELVKLQGERVRGLKQQKASAKAQLGPDESKQKFVLKTPKALEEKIRT 67
39 -11.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  11  15.............................LDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKM--RLTHSMILHKQLAIAMG--------KIFVLSPNIRLESRQKDDGREFTQLDFEV----ERAKMEDIMRLIERLVYGL--------------FRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILWEYEKIVAKIRKAGLNE---------DSFRPYLEI-----------------------AKAGKLKPSAGAGIGVERLVRFI.......... 272
40 -11.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  2..........MSETATWQPSASIPNL----LKRAAIMAEIRRFFADRGVLEVETPCMSQ----ATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG----PVFQLCRSFRNEEMGRHHNPEFTM--LEWYRPHYDMYR--LMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEI-DPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQAS-------------LAQISTEDHRVAERFEYYKGIELANGFHELTDAREQQQRFQNLLDALAAGLPCSGVALGVDRLVMLALGAESLAD.. 317
41 -11.4003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  22.PDSRVPVFNREFATFTGA-GVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFK--VSGHIEFYRNNMYLF-DIEGHEFAVKPMNCPYHILLFLNEVLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDFEEMKLVLERLFKLGVSSETFKVLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAA--KLDFIMMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHRRGRVKTGGEVDREIEDLASSIAKGLLDKGFRVAVK................ 377
42 -11.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  11  244.............................FRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY---------LAQSPQLYKQMAIMGD--------KVFEVGPVFRAENSNTRRHTEFEGLDIE--------------------------------MEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTT-VKLGELIKAKYNTDFYILDKFPAAIRPFYT--SYDVFVRG--QEITSGAQPEFLMKRC-GSWPHAGCGIGLERITMLY.......... 527
43 -11.1005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  22.........RSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGF-SPEVAWVTHYGDSPIAIRPTIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQP-RTREFLWQEGHTAHATEEEAWLDILELYRRWYEECLATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGL--VIPPRVASVQVVIIPILFKDENTGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYN-----HWEVKGVPLRLELGPK--RVVRRDTGEAYQISWADLAPKLLELMEGIQ...... 391
44 -11.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  30.........KSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGF-SPEVAWVTKSGKEPIAIRPTIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHP-RTREFLWQEGHTAHSTRKEAL-EMVDIILNEYASISIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNQVIIIPIIFKTVITEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYN-----HWEVKGVCLRFEVGPR--RVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFK 405
45 -10.9004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  18.DWYTQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGF-SPEVAWVTKYGDSNIAIRPTIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQP-RTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRWYEESHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFY--KTTDENAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFN-----HWELRGIPIRIEVGPK--VIVRRDNNEKCNVKKESVLLETQQMLVDIH...... 395
46 -10.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  11  28...........................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQ----ATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG----PVFQLCRSFRNEEMGRYHNPEFTM--LEWYRPHYDMYR--LMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEI-DPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQAS-------------LAQISTEDHRVAERFEYYKGIELANGFHELTDAREQQQRFQNLIEALKVGMPCSGVALGVDRLVMLALGAETLAE.. 330
47 -10.8005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  11  23.........RGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGF-KPEVAWVTHYGDSELAIRPTIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQP-RTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVIIQAATSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGL--VLPPRVVAVQAVIIPIIFKETGGMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFN-----DWELKGVPLRLEIGPR--RVVRRDTSEARNVPWAEAASTIPAMLET........ 390
48 -10.7002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  18.ELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQFEALNLPKSHPARDMQDSFY------TDEILMRTHTSPVQARTMEKRNGQGPVKIICPGKVYRRDSDDATHSHQFTQ--IEGLVVDKNIKMSDLKGTLELVAKKLFGADREIRL..................................................................................................................................................................... 186
49 -10.7001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  13  262....................GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWE--KTGHWDNYKDAMFTT-SSENREYCIKPMNCPGIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLST---RIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKI-----EFTLYDCLDRAWQCGTVQLDFSLPSRLS-ASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLA-TDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFK....... 581
50 -10.5005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  11  23.........KAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGF-APEVAWVTRAGDQPVAVRPTVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHP-RTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGD-VGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFN-----HWEVKGVPLRVELGPR--AVAVRHSGARHSVAWDAQTPAAVAALLED....... 397
51 -10.4001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  11  28...................KGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEIKGFEDEVYWVTHGGKTQLDVKLALRPTPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHT-LREIMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPYLISKRPE................................................................................................................................................................... 196
52 -10.3001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  74...EAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESFDALNIPEHHPARDMWDTFWPLGEEVEGRLLLRTHTSPMQVRYMVAHT--PPFRIVVPGRVFRFEQTDATHEAVFHQ--LEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRF..................................................................................................................................................................... 253
53 -10.3003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  180........................LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKT--AQLSQFDEELYKVIDGEDEKYLIATSEQPISAEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVVGI..................................................................................................................................................................... 339
54 -10.2004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11  11...........................LLQEQILTVKRSFSEALKELNLVEVRAPILFRVG--DGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVDQWDWEM----VMKDDQRNLAFLKEVVCKV--------YAAIRKTELAVCEKYKQKPILPETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEAS--SKPIPTMNSLSSLKGLNGDILLYNPTLDDSLEVSSMGEWHQQLLNGEFP-QTVGGGIGQSRMVMFMLRKKHIGE.. 334
55 -10.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  10  134.............................LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF---------LTQSSQLYLETCIPTLG-------DVFCIAQSYRAEKSRTRRHAEYAHVEAEC----PFITLDDLMEKIEELVCDT-----------------VDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAI----------KWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYM---VDLLMPGVGEIVGGSMRIWKFQRLYGTC-PHGGYGLGLERFICWLTNTNHIRD.. 424
56 -10.1003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  156.............................LQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY---------LTQSSQLYLESVIASLG-------KSFCMLSSYRAEQSRTVRHAEYLHLEAEL----PFISFEDLLNHLEDLVCTV--------------IDNVMAVHGDKIRKM-----NPHLKLPTRPFKRMTYADAIKYC-----------NDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYM---VDLLMPGVGEIVGGSMRIWNYQRKYGSC-PHGGYGLGVERLVMWLLGEDHIRK.. 443
57 -9.9405xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  11  164.............................LKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF---------LTQSSQLYLETCLPALG-------DVFCIAQSYRAEQSRTRRHAEYTHVEAEC----PFLTFDDLLNRLEDLVCDV----------------------------VDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYM---VDVLMPNVGEIVGGSMRIFDSQRKYGTC-PHGGYGLGLERFLTWILNRYHIRD.. 453
58 -9.8101x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  11  135.............................MKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAY---------LSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD---------------------------------LWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWG---DDLGADEERVLTEEFDRPFFVYGYPKHIKAFYM-LASDMLAPEGYGEIIGGSDYDKLLNRYGSV-PHSGFGLGVERLVAWVLKLDHIRW.. 421
59 -9.7401asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  14  181.............................FRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY---------LAQSPQFNKQQLIVAD--------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLS------------TENEKFLGKLVRDKYDTDFYILDKFPLEIRYTMPDPANPKYSNSYDFFMR----------GEEILSGAQHALLQERM-GCPPHAGGGIGLERVVMFY.......... 469
60 -9.7101efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  10  117..EEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL---------TKSTPEGARDFLVPYRHEPGLFYALPPQLFKQMLMVAG--------RYFQIARCFRDEDLRADRQPDFTQLDLEM----SFVEVEDVLELNERLMAHV---RFGLELKEVG-FRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEALAYDLVLNGVE---VGGGKFGFFLEEYGAP-PHGGIAWGLDRLLALMTGSPSIRE.. 544
61 -9.6705w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  130LDEPAGEELRLKYRYLDL---RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI---------TRSTPEGARDFLVPARLHPGSFYALPPQLFKQLLMVAG--------RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVDAEDIIAISEEVLTELAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAADAYDIVCNGHE---IGGGKFGFLLEAFMFGAPP-GIAFGWDRTTALLAGMDSIRE.. 569
62 -9.6604j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  11  210.............................FRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY---------LAQSPQLYKQMCICAD--------KVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYHYH---EVMEEIADTMVQI--------------FKGLQERFQTEIQTVNKQFPCEPFKFLEPTLR------------LEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYT---YDMFMRG--EEILSGAQPQLLTERA-GAPPHAGGGIGLERVTMLF.......... 494
63 -9.5701nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  10  55...................KGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGF-EDEVYWVTSKLQRKLALRPTVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIPYLITRRPPWDKFPGVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDES-VVIVPIIFKKAAEEVMEACRELRSRLEAAGF--RVHLDDR-----DIRAGRKYEWEMRGVPLRVEIGPR--VISRRDTGEKVTADLQGIEETLRELMKDILEN.... 412
64 -9.57011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  1.....................MKTAYIAKQRQISFVKSHFSRQLERLGLIEVQAPIL--SRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHYVDQWDWERVMGDG-----RQFSTLKSTVEAI-----------------WAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNG-----DILVWNPVLEDAFELSSMGDADTLKHQLGEMPQTIGGGIGQSRLTMLL.......... 304
65 -9.5201n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  12  125.............................LKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY---------LAQSPQLYKQIMVGVFE-------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIADEE---DLMRLEEALLAEM--------------LEEALNTAGDEIRLLGATWPSFPQD---PRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRSFDLLFR----------GLEITSGGRYEELLESL-GMPPHGGFAIGAERLTQKL.......... 401
66 -9.5203ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  15  49....................GSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMNCPGIFGKKDRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTRPDHAEQVLKEILEESGKPWKLNPGDGAFYGPKL-----DIMVTDHLRKTHQVATIQLDFQLPERFD-LKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSN----------EGRWPFWLNPYQAVIIPVNQLDMCTALQKKLRNE....... 368
67 -9.4203ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  1...........................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPR---EMAVELMNPLSQELNCMRQTLLFGGLETLSHNRKHLSLYLFEWGKCYRFHAAKRAAYAEDDRLGIWICGQRVHNS-FELKAVVEQVLCRVGIETGAYTLKT................................................................................................................................................................... 162
68 -9.3103ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  1...........................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPS---KNLVMLLNPLSADLNCMRQTLLFGGLESIAHNRKNADLKFFEFGNCYHFDAEKKAPYSEDYHLGLWVTGKMVSNS-YELKAYVENIFKRLGLDLHSLVVGN................................................................................................................................................................... 162
69 -9.1404rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  10  111LDEQAGEEARLKYRYLDL---RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL---------TRSTPEGARDFLVPARLQPGSFYALPPQLFKQLLMVAG--------RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVEADDVIAISEQVLKAVAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQATLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPFDSDPGNALSDAYDIVCNGNE---IGGGKFGFLLDAFSYGAPP-GIAFGWDRITALLAGVDSIRE.. 550
70 -9.0404wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  121..VGEETRLRYRFIDLRRPE-----MAAKLKLRARITSSIRRYLDDNGFLDVETPIL---------GRPTPEGARDYLVPSRTYPGHFFALPPQLFKQLLMVAG--------RYYQIAKCFRDEDLRADRQPEFTQIDIET----SFLDESDIIGITEKMVRQL-LDVEFDEFPHMPFEEAMRRYGSDKPDLVADQLKEVEFKVFSGPANDAKGVEGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKLLTREWAPMWVYDMVLNGTE---LGGGKFGFLLDKYGAP-PHGGLAFGLDRLVMLMTGASSIRE.. 553
71 -9.0201wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  134.............................IKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAF---------LAQSPQLYKELMAGVVE-------RVFEVAPAWRAEESDTPFHAEFISMDVEM----AFADYNDVMQLLEKILHNI--------------VKTIKEEGKEELKIL-----NYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARYTKSKSENPELSESFDLIYK----------FLEIVSGSKREVLEEAL-GMPPHAGFGMGLARLMVML.......... 408

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.