current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2e1b_A mol:protein length:216 216aa long hypothetical alanyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MINMTRKLYYEDAYLKEAKGRVLEIRDNAILLDQTIFYPTGGGQPHDRGTINGVEVLDVYKDEEGNVWHVVKEPEKFKVGDEVELKIDWDYRYKLMRIHTGLHLLEHVLNEVLGEGNWQLVGSGMSVEKGRYDIAYPENLNKYKEQIISLFNKYVDEGGEVKIWWEGDRRYTQIRDFEVIPCGGTHVKDIKEIGHIKKLKRSSIGRGKQRLEMWLELast
1 -118.0002e1b_A mol:protein length:216 216aa long hypothetical alanyl-tRNA synthetase  ali model  100  1MINMTRKLYYEDAYLKEAKGRVLEIRDNAILLDQTIFYPTGGGQPHDRGTINGVEVLDVYKDEEGNVWHVVKEPEKFKVGDEVELKIDWDYRYKLMRIHTGLHLLEHVLNEVLGEGNWQLVGSGMSVEKGRYDIAYPENLNKYKEQIISLFNKYVDEGGEVKIWWEGDRRYTQIRDFEVIPCGGTHVKDIKEIGHIKKLKRSSIGRGKQRLEMWLE 216
2 -87.4003kew_A mol:protein length:241 DHHA1 domain protein  ali model follow..  29  2...SLTKLYYEDQYIKEFKGEIIEVKEIHVLLDQTAFFPGGGGQMGDLGLIDGIKVLDVYEEEGKVYHVL---EKEPKKLKNLQCELDWERRFDGMQQHLGQHLLSGCFYDLFGAN---TCGFHLGKEISTVDIVG-FLDEKTIREAEKEANRLIFENLEVKSYADEEIRIVEIVGLDLNACCGVHPRNTRDLQVIKIRRWEKH-KNATRIEYVA. 227
3 -68.3002zze_A mol:protein length:752 Alanyl-tRNA synthetase  ali model follow..  37  513.LPDTRRLYYEDPFMKEFDAKVLRVIKDWVILDATAFYPEGGGQPYDTGVLREVKVTNVQKV-GKVIIHKVEDPGAFKEGMIVHGKIDWKRRIQHMRHHTGTHVLMGALVRVLGRHVWQ-AGSQLTTDWARLDISHYKRISEELKEIEMLANRIVMEDRKVTWVPGREIRVVKIEDWDVQACGGTHLPSTGLVGPIKILRTERIQDGVERIIFAC. 750
4 -57.2003rhu_A mol:protein length:160 SC_1wnu  ali model follow..  22  2...........................................................................................YSIEVRTHSALHVVKGAVVKTAGSDAKWTTSTYVKGNKGVLIVKAALEPDWGIAAIEALANEKVKENAPIKIEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRRKSKGLLEIHFEL. 150
5 -57.1001v7o_A mol:protein length:165 alanyl-tRNA synthetase  ali model follow..  24  2...........................................................................................YSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSEEIREIERLANEKVKENAPIKIEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRRKSKGLLEIHFEL. 150
6 -56.6003wqy_A mol:protein length:906 Alanine--tRNA ligase  ali model follow..  32  501.YPATEKLYYDDPTLLEFEAEVIGVEGDFVILNRSAFYPESGGQDNDVGYLGKFEVVDVLEADGVVLHVV--KGAKPEVGTKVKGVIDSDVRWRHMRHHSATHVLLYSLQKVLGNHVWQ-AGARKEFSKARLDVTHFRRPSEEIKEIEMLANREILANKPIKWPPGRKIRVVQV-GDDVQACGGTHCRSTGEIGMLKILKVESIQDGVIRFEFAA. 736
7 -55.0003rfn_A mol:protein length:159 BB_1wnu_001  ali model follow..  22  3.............................................................................................IEVRTHSALHVVKGAVVKAAGSAAKWTTSTYVKGNKGVLIVKAALELDWAWAAMEALANEKVKENAPIKIEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRRKSKGLLEIHFEL. 149
8 -13.0004v1a_c mol:protein length:334 MITORIBOSOMAL PROTEIN ML39, MRPL39  ali model follow..  37LIEMQNDLF--NKEKNRQLSLTPRTEKIEVKHVGKT--DPGTVFVMNKNISTPYSCAMILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETL-ERIVKLHRFGDF-IDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVR.... 291
9 -8.8701qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  1MPVIT----LPDGSQRHYDHAVSPMDVALDILAKACIAGRVNGELVDA-------------------------CDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPH--TKMAIGPVIDNGFYYDVDLDRTLTEDVEALEKRMHELAEKNYDVIKKKVSWHEARETHEEYVDMCRGPHVPNMRFCHHFKLMKTAG............. 203
10 -8.1103j7y_7 mol:protein length:338 mL39  ali model follow..  46..................................DLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVYSCAMHLSEWYCRKSILALVDGQGEVNKAYWRSCAMMMGCVIERAFKDEYMRAPEVPVISGAFCYDVVLDSPTKENLRSFTKDAHALIYKDLPFEVEAKVALEIFQHSKYKVDVSEGPLIPRTSICFQYEVSAVPTQPSLIRRFQGV.. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.