current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2el9_A mol:protein length:431 Histidyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst GPGYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLGLast
1 -131.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model  100  1GPGYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG 431
2 -121.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  54  3........MSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKSVPAVGFAMGMERLLLLLEQVEQAEI--VRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRISQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFT 431
3 -121.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  41  2........PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLR-RLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRP---RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG 423
4 -121.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  38  2...........IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLK-HLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHN--GIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK... 420
5 -116.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  52  17..TEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDANGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLT-GIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE-QEGVDVYVVHQGDAAREQAFIVAERLRDTDVILHCSADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMV 453
6 -106.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  22  13.PGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEAVKELRQFFEQVEAYGYGVLFDASVVRGLAYYTGIVFEGFDRE-GKFRALCGGGRYDNLLTTYGSPPIPCAGFGFGDCVIVELLQEKRLLPDIPHVVDDVVIPFDESMRPHALAVLRRLRDA--GRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL... 446
7 -103.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  25  3........RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEE---LLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRK-DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMSDPFSVFSIIDRYHKISREEFVDQRSAGIGEDGVSMIADLCSGTRGIDEMAR--ITGKSSEEIARMAAVEDLLASYGVKVRYDFSIVRGLSYYTGIVFEAYDRS-GQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIP-REKKSVYICRVGKINSSIMNEYSRKLRER--GMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQAT 426
8 -102.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  23  1SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNI-GDFVIRINNLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKKIDGSVDDVLDKLKHLSQTLPELGVSELETVITGVRNLGVPFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTPPTPAQVVVVNMQDELMPTYLKVSQQLRQ--AGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT 465
9 -101.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  23  12GPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSDVGVKINSAGVSADKFAPVCVIVDKMEKLEEVVAQLAAIGLESNVVDAITSTLS-----LKTIDEIAQRIGEEAVRELRDFITQIEAYGFGVIFDASVVRGLAYYTGIVFEGFDRD-GNFRALCGGGRYDNLLTTYGSPTVPCVGFGFGDCVIVELLNEKKLLPELHHVVDDLVIPFDETMRPHALSILRRLRDA--GRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV... 446
10 -99.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  22  58..PDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQI-GDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVADRIGDGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEETTETQVLVASAQKKLLEERLKLVSELWD--AGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 514
11 -97.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  22  4.SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQI-GDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVADRIGDGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEEKTETQVLVASAQKKLLEERLKLVSELWD--AGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 461
12 -86.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  20  1..SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV----GVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLS-EFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYRKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASVKFDLTLVLHMSYYTGVVFEGYGNRLGV--PLCSGGRYDELLSKFHR-PAQATGFGVRIDLLVEALNGEII----SNGHEQTCILFSNERRFEAIELARKKRAN--GEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA............................. 400
13 -78.5001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  20  6.SIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLN-KTVFEIGSAKFFQRLCQLADGSTELLTELLLKLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQPILSGGRYDQLLSNFQE-EAFAIGFCCHMDTILKALERQELEEDND.................................................................................................. 338
14 -75.0006FTT Entity 1(prereleased)  ali follow..  18  3.............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHG--GDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQ--GYRVTMPLTAEDMPVGLTHADNQWRLHAV....................................... 388
15 -75.0005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  18  3.............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHG--GDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQ--GYRVTMPLTAEDMPVGLTHADNQWRLHAV....................................... 388
16 -74.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  21  12GARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS---RDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVVDMDVLRLLHEASAAAGVR-HHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRENLLTWSPAERDAAKRSREASDRELEALLRDAWRYLCRLAEALHDSGLAVTFDLALHRELDYYTGLVFEMFAPGVG--APIAQGGRYDELLAQFGA-GAPAVGFAFEVERVMAVLEAQEEGEGE................................................................................................... 372
17 -59.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  18  2...................DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP-------------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSGSD---LVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEG-PVIVEIGHTGVYEDHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVR-----EDLLSASSFLQEKTVSVEIDLTLARTIEEYCGLIFTIYDTSSSR--LVAAGGEYTVNGE-------KGVGGSIFLEGK................................................................................................................ 273
18 -50.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  31...RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI--DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKKNIKRAARSESYYNGISTN............................................................................................................................................................................................. 267
19 -47.4002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  3........................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIELGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQD--AGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 164
20 -46.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  45...RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI--DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID-KPWIGAGFGLERLLKVKHDFKNI---------KRAARSESYYNGISTNL............................................................................................................................................................................. 282
21 -42.2005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  31...RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDF--KIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKERLLKVKHDFKNIKRAARS........................................................................................................................................................................................................... 257
22 -42.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  48...RELESELLSRRKKDLQQIYAEERNYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI--DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGA-----------FGLERLLKVKHDFKNIKRAARSESYYNGISTNL............................................................................................................................................................................. 285
23 -37.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  30...RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGIDFKIVGD----------------------------------------------------------------------------------------------------SCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK........................................................................................................ 248
24 -36.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  48...RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID.......................................................................................................................................................................................................................................................................... 204
25 -32.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  48...RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVGD----------------------------------------------------------------------------------------------------SCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK........................................................................................................ 266
26 -29.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  51.....SDALSRDRAFQGIEHRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGED----HPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIRE......................................................................................................................................................................................................................................................................... 220
27 -27.2002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  16  48............QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRES--GRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGLK-AIPMRAETDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIE-VGQIFYFGTK-------YSDSMKANVTGPDGTDAPIHGG-------------------YGVGVSRLLGAIIEACIWPEAVAPFRVTILNLKAATDAACDQLYRELSA--KGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.... 452
28 -23.9002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  16  34............QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKES--GRYETYGPNLYRLKDRNDRDYILGPETFTELIRDEINS--YKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLE--FRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVVLAFTKGIEI--GHIFKL-------------GTRYSDVLDENGREKSVIMGYGIGVSRLLSAIVEQNNWPTGIAPFDLHVVQMNEYQTKLSQEVEAMMTE--AGYEVLVDDRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMN 566
29 -23.9005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  16  36............RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQES--GRWEQYGPELLRLKDRHEREFCVGPEVITDLARNELNS--YKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLD--FRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRG-DLPLPEVADLRNVVEGDPSPDGKGTKYSEVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNLWPSALAPFQIALVPLKESVKQATDKLYAELTAAGFEVLLDDRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLS 572
30 -21.1004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  13..GRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPK--IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY------------GGKWPFWLS----------------------------------PRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLD-PGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 399
31 -21.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  11  29............YDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDH--EGFSPEVAWVTHYGDSPIAIRPTSETIMYPAYAKWRSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELVLDI---------------------------------------------------------LELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNF--AKMFEIEFEDEEGHKRLVHQTSW-----------------GCTTRSLGVMIMTHGVIPPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRID-DRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELME 388
32 -21.0004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  9..GRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQA---------------------------------------------------------KQLENSLNEFGEKWELNS----GDGAFYGPKIDIQIKDAIGRYHQCATIQLDQLPIRFNLTYVSHDG---SVERMIAILTENGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLD-PGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 395
33 -20.9004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  12  56..........EYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE--KTHVADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAI-PVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFE----------------IVFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIGV-----MTMVHGDNM--GLVLPPRVACVQVVIIPCGITNALSEEDK-------EALIAKCNDYRRRLLSVNIRVRADLR-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 423
34 -20.8005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  35..........EYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDH--EGFSPEVAWVTKSGKSDIAIRPTSETIMYPYFAKWRSHRDLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGT------KSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSK-----------------------------------------------------MFGVEFEDEKGNKEYAHQTSWGLTTRAIGV--IMTHGDNKGL-----------VLPPKVAPVQVIIIPIIEEQKKICNEVECILKKAGVRVKID-DRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLE 396
35 -20.7004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  31..........EYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNH--EGFSPEVAWVTKYGDSEIAIRPTSETIMYSVFPKWRSYRDLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRWYEEYLAVPIIKGIKSEGEK---------------------------------------------------------GGANFTSTAEAFISENGRAIQAATSHYLGTNF--AKMFKIEFEDENEVKQYVHQTSW-----------------GCTTRSIGIMIMTHGVLPPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYD-DRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLV 392
36 -20.6004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  40..........EYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE-KTHVADFAPEVAWVTRSGAEPIAIRPTSETVMYPAYAKWQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAI-PVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFE----------------IVFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIG------MTMVHGDNM--GLVLPPRVACVQVVIIPCGITNALSEEDK-------EALIAKCNDYRRRLLSVNIRVRAD-LRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 407
37 -20.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  12  27...DAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDH--KGFEAECFWVEQPLEERLALRPTSETAIYSMFSKWRSYKDLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQLSDY-------WKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSS-----------------------------------------------------TFDILYANKANESVHPYLTCA---------------GISTRVLACALSIHGDSVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKSKLGLRVSID-FSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSHTTE 401
38 -20.5004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  16  9..GKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT-----DNYKDAMFTTSSE-NREYCIKPMNCPGHVQIFNQGKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEK-------------------------------------VVKLSTRPEKRIGSDEMWDRA--------------------ADLAVALEENNIPFEYQL----GEGAFYGPKIEFTLYDCLDRAWQCGTVQLDSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSN--AGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 394
39 -20.5005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  10  32..............ISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDH--EGFKPEVAWVTHYGDSELAIRPTSETIMYPAYAKWRSHRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAV------------------------------------------------------------PVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNF--SRMFSIEFEDEKGAKQLVHQTSW-----------------GCTTRSLGVMIMTHGVLPPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVD-DRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLE 389
40 -20.4001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  12  16...EKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWKVHTDLPIKIYQIVNTFRYEKHTRPLIRLMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIP-----------YLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSK-----------------------------------------------------TFEIIFETPTGDKDYAYQTCYGISDRVIA--------------SIIAIHGDEKILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLN 380
41 -20.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  23....QKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEH--EGFSPELAVVTHAGEEPLAVRPTSETVIGYMWSKWRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEVRRMLSIYAR---LAREYAAIPVIEGLKTEKEKFAGA---VYTTTIEALMKDGKALQAGTSHY------------------------------------------------------LGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIG--------------AIIMTHGDDRVLPPRLAPIQVVIVPIYERVLEAAQGLRQALLAQGLRVHLD-DRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLD 386
42 -19.8001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  15  43...EEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGF-EDEVYWVTSKLQRKLALRPTSETVMYPMFALWRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIP----------------------------------------------------------YLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHN------LGQTFARTFEIKFETPEGDHEYVHQTCY-GLSDRVIASVIAIHGDESGL-----------CLPPDVAAHQVVIVPIAEEVMEACRELRSRLEA--AGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMK 407
43 -19.7001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  261...............AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS-GHWDHYQEDMFPPMQLDETESMVLRPMNCPHHMMIYANKHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGF-EDYSFRLS-------------------------------YRDPEDKEKYFDDDDMWNKA--------------------NMLKEAADELGLSYEEAI----GEAAFYGPKLDVQVKTAMGKEETLSTAQLDTYIGQDGEHHRPVVGVVSTMERFVAFLTEEGAFPTWLAPKQVQIIPVNVDLHDYARQLQDELKS--QGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIR 640
44 -19.5005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  30............YDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDH--EGFAPEVAWVTRAGDTEVAVRPTSETVMYPYYAKWRSHRDLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLAVP-VVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIR------------------------------------------------------------FQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGM-----------VMPPRVASTQVIIIPVGQELLASCWRLESELCE--GGVRARCD-DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAAL. 394
45 -19.3001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  15  29...............QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS-PRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE-NLVPYQQPPES-------------SAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG---------KWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI-----------------LVKNRPEITEYAKRLKARLLAL--GLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 441
46 -19.2003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  11  40................GVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVS-----EFYRNNMYLFDIE-GHEFAVKPMNCPYHILLFLNERSKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDYDVFEEMKLVLERLFKLGTFKVRLSMSDKSLIGKEFMGSKEEWEGAE-------------------------------------------------EALREAASRINEKYGIDIVELEGEAAFYGPKLDFEESGVSKEWQMGT--RFR-VVREEFGIEEVYIALLGSIERFLGVYLEHGRMPFTLAPIQFAVIAVKTGGEDLASSIAKGLLDKGFRVAVKGS-SKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVE 440
47 -18.1001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  16  248..GKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT-----DNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKI------------------------------------VVKLSTRPEKRIGSDEMWDRA--------------------ADLAVALEENNIPFEYQL----GEGAFYGPKIEFTLYDCLDRAWQCGTVQLDSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSN--AGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 633
48 -17.8003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  35..SQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS-----ENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKKRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVK---------------------------GGSGAESNYFINFSTRPDHFIGDLKVWNHA--------------------QVLKEILEESGKPWKLNP----GDGAFYGPKLDIMVTDHLRKTHQVATIQLDKFKDQDNSYKRPIMATFGSIERFMALLIDSGRWPFWLNPYQAVIIPVNTKNVQQLDMCTALQKKNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEK 451
49 -17.1001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  16  104...KEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPP--RYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFVLDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE-NLVPYQQPPES-------------SAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG---------KWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI-----------------LVKNRPEITEYAKRLKARLLAL--GLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 504
50 -15.5001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  13  4..........................................................................................................................................................................................................................................................................................................................................GSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYE 106
51 -13.2002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  16  90..............VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSVDKFADFMESVLAQLDNYGQQELALRPETAQGIFLNFLLEFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSLYLTKVGISPDKLRFRQHMENEMAHYACD-CWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDDECYITEMEMLLNEKGEFTIETEG-LTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDEQRTFFLSQNQEFMPFVKELSEALTRH--GVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLAN 657
52 -13.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  15  1...........MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGL-----------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGLKAEEWTGREFPRARHFK-VYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKLPYGYGEVSS--GGEREWEYEKIVAKIRAAGLK-------EDSFRPYLEIA------------------RA--------GKLKPSAGAGIGVERLVRFI............................................................................................................ 272
53 -13.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  1...........MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMG--------------KIFVLSPNIRLESRQKDDGREFTQLDFEVERAK------DIMRLIERLVYGLKAEEWTGREFPKTKRFE-VFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRLPYGYGEVAS--GGEREWEYEKIVAKIRKAGLN-------EDSFRPYLEIA------------------KA--------GKLKPSAGAGIGVERLVRFI............................................................................................................ 272
54 -12.6003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  13  1................GMSETATPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAG--------PVFQLCRSFRNEEMGRHHNPEFYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPFIYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLP-QNLLDALAAGLPDCSGVALGVDRLVMLALGAE........................................................................................................ 313
55 -11.9003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  12  134...SSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY---------LTQSSQLYLESVIASLG---------KSFCMLSSYRAEQSRTVRHAEYLHLEAELPFIS------DLLNHLEDLVCTV---------------IDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMK-HPDLTESVDLLMPGVGEIVGGSMRIWNY-LNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWL............................................................................................................ 435
56 -11.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  125.........................LKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY---------LAQSPQLYKQIMVGVFE---------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIAD-----DLMRLEEALLAEMEALNTAGDEIRLLGATW-RLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEED-----GTTRSFDL-------LFRGLEITSGGQRIHRYEELLESLKAKG-EAFHGYLEVFKYGMPPHGGFAIGAERLTQKL............................................................................................................ 401
57 -11.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  181.........................FRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY---------LAQSPQF---NKQQLIVADFE-----RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEH-----EVLDTLSELFVFIELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLT------------KEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIR-NPKYSNSYDFFMR--HALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFY............................................................................................................ 469
58 -11.8003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  13  28.......................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAG--------PVFQLCRSFRNEEMGRYHNPEFYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPFVYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLP-QNLIEALKVGMPDCSGVALGVDRLVMLALGAE........................................................................................................ 326
59 -11.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  14  164.........................LKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF---------LTQSSQLYLETCLPALG---------DVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLT------DLLNRLEDLVCDVRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCP-----------DSRLTESVDVLMPNVGEIVGGSMRIFDS-IDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWI............................................................................................................ 445
60 -11.4004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  210.........................FRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY---------LAQSPQL---YKQMCICADFE-----KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYH-----EVMEEIADTMVQIGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEK---------LLGHLVKEKYDTDFYILDKYPLAVRPFYTMNPKQSNSYDMFMR-------------EEILSGAQIKAYIDSFRFGAPPHAGGGIGLERVTMLF............................................................................................................ 494
61 -11.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  16  244.........................FRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY---------LAQSPQL---YKQMAIMGDFR-----KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVEN-----ECIDVMEKLFTFIEIPKRFPDELKVIRKQYPRLTYKEAIEMLRASGETGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYD-----------FVRGQEITSGAQPEFLMKRCIEKGV----ATLKDYIESFRFGSWPHAGCGIGLERITMLY............................................................................................................ 527
62 -11.3001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  134.........................IKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAF---------LAQSPQLYKELMAGVVE---------RVFEVAPAWRAEESDTPFHAEFISMDVEMAFAD------DVMQLLEKILHNI---------------VKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKNPELSESFDLIYK-------------LEIVSGSTFEFFLKWFDYGMPPHAGFGMGLARLMVML............................................................................................................ 408
63 -11.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  12  134.........................LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF---------LTQSSQLYLETCIPTLG---------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFIT------DLMEKIEELVCDTDEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDA-----------DNTLTESVDLLMPGVGEIVGGSMRIWKF-IDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWL............................................................................................................ 416
64 -11.1001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  14  135.........................MKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAY---------LSQSAQLYLEAAIFGLE---------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYMRTLELRKKEIEMFRDDLTTLKNTEPPFPRIS-YDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDP--NDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGKDYEWYLDLRRYGSVPHSGFGLGVERLVAWV............................................................................................................ 413
65 -11.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  48...............DGVYARTALYESIVERLAALITSHRE-AGTEALRFPPVMSRAQLEKEINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLTFRVDYASDPF--------------------------------AGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHR-----------------------EHFGTT-WGIQDAN---------------------GEPAHTGCVAFGMDRLAVAM............................................................................................................ 305
66 -10.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  48...............DGVYARTALYESIVERLAALITSHRE-AGTEALRFPPVMSRAQLEKEINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLTFRVDYASDPF--------------------------------VGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHR-----------------------EHFGTT-WGIQDAN---------------------GEPAHTGCVAFGMDRLAVAM............................................................................................................ 305
67 -10.7001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  137.........................FKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF---------LAESPQL---YKEIMMASGLD-----RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIED-----EVMSFLERLVAHAYVREHNAKELDILNFELERVSYDKALEILGDLGKEPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFD-----------EYRGVEISSGGQREHRHDILVEQIKEKG-ESFEFYLKAFRYGMPPHGGFGLGAERLIKQM............................................................................................................ 417
68 -10.4002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  11  77...............GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC---LAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 463
69 -10.3004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  71................CHPGFGPLGVELRKNLAAE-EQVFPVDALHHKPGPLLPSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC-------APIKVALDVGTLELRQVCQGLFNELLENGISVPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 456
70 -10.1005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  94...............GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC-------APIKVALDVGTLELRQVCQGLFNELLENGISVPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 480
71 -9.9205w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  134...AGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRST------GARDFLVPARLHP-----GSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVDAEDIIAISEEVLTELLIGYRIPTPIPRIGYAEAMRRFGTDKPDL-GTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFESDTGSVLADAY-----------DIVCNGHEIGGGKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGM------DSIREVIAFPKTGGGVDPLTDAPAPITAQQ..................................................................... 594
72 -9.8104rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12  115...AGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRS---------TPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVEADDVIAISEQVLKAVTIGYDLPLPLPRISYEEAMRRFGSDKPDL-GTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFDSDPGNALSDAY-----------DIVCNGNEIGGGKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGV------DSIREVIAFPKSGGGVDPLTDAPAPITPQQRGIDAKPREDKPKEDAKSKAAAA.............................................. 601
73 -9.7701efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  13  123....SEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKS---------TPEGARDFLVPYRHEPGLFYAL-PQSPQLFKQMLMVAGLD-----RYFQIARCFRDEDLRADRQPDFTQLDLEM----SFVEVEDVLELNERLMAHVKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLEKDPGRVRALAYDLVLNGV----EVGGGSKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGS------PSIREVIAFPKNKEGKDPLTGAPSPVPEEQ..................................................................... 569
74 -9.7701g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  56...................RFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPES-FLENLLKTSGKLRATLLHGALEHYCLDLVNRKLPFGLAQIGVCFHPVSNSNQRVGEKTEASLVWFTPTRTSSQ---------------WLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYL--------YDSFQLAENSFARKKSLQRKVL----------------------------KLHPCLAPIKVALDVGKGPT-------VELRQVCQGLLNELLENGISVWPGYSETHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLA 438
75 -9.7403qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  11  180....................LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMA-KTAQLSQFDEELYKVIDGEDEKYLIATSEQPSAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVGIVSGELNNAAAKKYDLEAWFPFQQEYKE----------------------------LVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVHCLN-------------------------------------------------STLSATERTICCILENYQKEDGLVIPEVLRKYIPGEPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKN............................................... 476

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.