current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2i4l_A mol:protein length:458 Proline-tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVSRLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLTLast
1 -132.0002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model  100  1MGSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVSRLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT 452
2 -115.0005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  45  3..............MRTSQYLLSTLKETPADAVVISHQLLLRAGMIRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPREFGVNWERDLPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESVKQATDKLYAELTAAGFEVLLDDRDKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFIT 568
3 -114.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  40  1..............MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVSRLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLS 562
4 -86.9005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  19  7..........................KKDENFSEWYTQAIVRSEMIEYYISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHLEKEKDHVEGFSPEVAWVTHYGDSPIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENG---------------------------------------------------------RGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTT-RSLGVMIMTHGDDKGLVIPPRVASVQVVIIPIDENTGEILGKCRELKTMLEKADIRVRIDDRNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLL 384
5 -86.8004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  17  24............GPKKQTRLGLEAKKE--ENLADWYSQVITKSEMIEHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASG---------------------------------------------------------RAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNEALIAKCNDYRRRLLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQ 419
6 -86.2004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  17  6..........GQGPKKQTRLGLEAKKE--ENLADWYSQVITKSEMIEHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASG---------------------------------------------------------RAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNEALIAKCNDYRRRLLSVNIRVRADLRNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQ 403
7 -85.5004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  20  1...............MASNILGITSKKIENFSD--YTQVIVKSELIEYYISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNLEKEKNHIEGFSPEVAWVTKYGDSEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANF---------------------------------------------------------TSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTT-RSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTTDIHSYCKDIEKILKNAQINCVYDDRSYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQ 388
8 -85.2005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  19  8..........................KKSTNFADWYTQVIVRGELVEYYISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQALEKEKDHVEGFKPEVAWVTHYGDSEVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDT----------------------------------------------------------RGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTT-RSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGIVAKCRELERLLNAAGVRVKVDDRNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIP 385
9 -84.4001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  24  1MGSSSSGLVPRGSHMPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIRYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDLAKEAIHVKGFEDEVYWVTSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAF-----------------------------------------------------------DTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGL-SDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLR 403
10 -83.9005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  16  2............ASKENESLLGITADK-ITSFADWYSQVIVKSEMIEYYISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKLETEKDHVEGFSPEVAWVTKSGKSDIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTPFIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDI---------------------------------------------------------TKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTT-RAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPITVITEEQKKICNEVECILKKAGVRVKIDDRNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIP 392
11 -83.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  19  1..............MAMGGDVTFSLTKTRDTFADWFDAIMDAAELVRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFKKESDHIKGFEAECFWVEQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADY----------------------------------------------------------SEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGIS-TRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKKSKLGLRVSIDDDSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSS 397
12 -80.8005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  19  1..........................GAMGIAAKREENVITKAEMIEYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSLEREKDHIEGFAPEVAWVTRAGDTEVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDY---------------------------------------------------------TTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKQELLASCWRLESELCEGGVRARCDLRDNSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAV 391
13 -80.6001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  20  2..........................SHMLEFSEWYSDILEKAEIYRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDG-----------------------------------------------------------RTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISD-RVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVE 376
14 -78.4001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  21  1................MAKEKGLTPQS--QDFSEWYLEVIQKAELAYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSLRKEAEHVEGFSPELAVVTEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTR-PFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVY----------------------------------------------------------TTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGL-SWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIDESRERVLEAAQGLRQALLAQGLRVHLDDRQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALP 382
15 -78.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2.............................GSSSSGDHRKIGRLYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQIEDE-IKGCLDFLRTVYSVFGFS-FKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKI-----------------------DIQIKDAIGRYHQCATIQLDFQLPIRF----NLTYVSHDGDKRPVIVHRAILGSVERMIAILTENYGGK---WPFWLSPRQVMVVPV---GPTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQ 395
16 -77.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  21  2.................................ARDHRKIGKLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFCTEEQIRDE-VNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKI-----------------------EFTLYDCLDRAWQCGTVQLDFSLPSRL----SASYVGEDNRKVPVMIHRAILGSMERFIGILTEEFAGF---FPTWLAPVQVVIMNI---TDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQ 390
17 -77.0004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  2.................................ARDHRKIGRLYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQIEDE-IKGCLDFLRTVYSVFGFS-FKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKI-----------------------DIQIKDAIGRYHQCATIQLDFQLPIRF----NLTYVSHDGDKRPVIVHRAILGSVERMIAILTENYGGK---WPFWLSPRQVMVVPV---GPTCDEYAQKVRQQFHDAKFMADIDDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQ 391
18 -76.4003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  12  5.................QDKTHIDYAYELDITVKPDSRVPVFREFATFTGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLFDI-EGHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSYGLLRVRGFTQDDAHIIVPGGRVIDV-VYDVFEEMKLVLERLFVRLSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDEGEAAFYGPKLDFIM--------------------MVEESGVSKEWQMGTIQFDFNLPRRF----RLYDVVREEIEEVYIIHRALLGSIERFLGVYLEHRRGR---MPFTLAPIQFAVIAVKTGGREIEDLASSIAKGLLDKGFRVAVKGSSKGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAA 436
19 -76.4001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  19  197.LLSTAGAYWRGDSNMLQRIYLKAHLQMLEERKERDHRKIGKFTNSQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPMLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGASGLQRVRGMTLNDSHIFVRPDQIKEE-FKRVVNMIIDVYKDFGFEDYSFRLSEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKL-----------------------DVQVKTAMGKEETLSTAQLDFLLPERF----DLTYIGQDGHHRPVVIHRGVVSTMERFVAFLTEETKGA---FPTWLAPKQVQIIPVN--VDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLV 636
20 -74.3003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  5............SSGLVPRGSHMASKNASSATPATMTSMVSQLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGASGLTRLRKFHQDDGHIFCTPSQVKSE-IFNSLKLIDIVYNKIFPFVKFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKL-----------------------DIMVTDHLRKTHQVATIQLDFQLPERF----DLKFKDQDNSKRPIMIHRATFGSIERFMALLIDSNEGR---WPFWLNPYQAVIIPVNTKNVQQLDMCTALQKPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKFEKLTMSQIWEKFI 447
21 -72.7001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  21  198.LMKTAGAYWRGDSNNLQRIYLNAYLQRLEEAAKRDHRKIGKLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFCTEEQIRDE-VNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKI-----------------------EFTLYDCLDRAWQCGTVQLDFSLPSRL----SASYVGEDNRKVPVMIHRAILGSMERFIGILTEEFAGF---FPTWLAPVQVVIMNI---TDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQ 629
22 -50.6001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  2.........................ASSLDELVALCKRRIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGE-DEYWHRYWVEERLKWWQEMGLSRENLVPYPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGIT-----------------------ARVLRNEHSTQRLAYRDPETG--KWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERI----LKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLR 437
23 -42.9002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  15  45..........KARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGEPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSASKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREFSFPAVVAPFKCSVLPLS-QNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQ 653
24 -41.7001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  14  1............................AASSLDELVALCKRRGFIFQSSQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGE-DEYWHRYWVEERLKWWQEMGLSNLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLA-------------------------YRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERI----LKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLR 500
25 -37.5003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  11  123............ENNELVRTWTPENYKKPEAPAKLSHHEVLLR--VRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFSPAEQLPVRYAGYSSCFRREAKDAWGIFRVHAFEKIEQFVLTEPEKS-WEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKEAWFPFQQEYKELVSCSNCT--------------------------------------------------------------DYQSRNLEIRCGIKQQNQQEKCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY--------PGEPEFIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKNG.......................................... 477
26 -35.6002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  14  165LLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEE-VLKCAEELHDRYMHIFNDILDIEW-RKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDG--------------------------------------------EWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVGLERWAAVFLAQKGLDPA-NWP---EEFRNRVGEMPK................................................................................... 511
27 -32.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  14  1.MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLD--HLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTDLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMREYVCIGTPDD-VSDFRERWMVRAQAIARDLGLTFRVDYA---------SDPFFGRAGKMLANNQRDQQLKFELLIPLRS---------------------------------------EEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMDRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................ 323
28 -31.7003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  1.MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLD--HLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTDLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMREYVCIGTPDD-VSDFRERWMVRAQAIARDLGLTFRVDYA---------SDPFFGRVGQMKAVSQKQQQLKFELLIPLRS---------------------------------------EEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMDRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................ 323
29 -30.1003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  7..............................EAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRK---EEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIVGVKSVSAE---VELVCAACWAMRSLGLSSKDVGIKVNSRK-IPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGGGRYDNLLTT------GSPTPIPCAGFGFGDCVIVELLQEKR------LLPDIPHVVDDVVIPFD---ESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVP 445
30 -29.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  7..............................EAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRK---EEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIIGVKSVSSE---VELVCAACTAMQSLGLSSKDVGVKINSRKILQT-VIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRDGNFRALCGG-FGFGDCVIVELLNEKK------LLPELHHVVDDLVIPF---DETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLP 445
31 -29.6001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  16  1.............................................MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGDSTDVVQKEMYTFKDKGDRSITLRPGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYE-RKQKG--RYRQFNQFGVEAIGAENPSVDA---EVLAMVMHIYQSFGLKHLKLVINSGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLRGLDYHTAFELGGRYNGLLEL-----DGPSETGI---FALSIERLLLALEEEG------IELDIEENLDLFIVTMG---DQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFK 419
32 -29.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  21LVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL--MGKYGEDSKLIYDLKDQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRRI-RTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTTGVIYEAGGRYDGLVGM-----DPKGRKVPCVGLSIGVERIFSIVEQRLEALEE---KIRTTETQVLVASAQ---KKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIK 510
33 -29.5005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  33..LTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALL-RRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRT-SNQWLDFWLRHRLQWWRKFAMSPSNFSSDCQDEEGRKGNKLYYNFPWGKELI---------------------------------------------------------ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTELKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLI 476
34 -29.2001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  17  7...............................................EKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIK---EELLQQTYSFVDKGGREVTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYE-EPQAG--RYREHYQFNADIFGSDSPEAD---AEVIALASSILDRLGLDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAA-VRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGG-FGMGDAVISLLLKRENVQIPR-------EKKSVYICRVG---KINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLI 422
35 -29.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  1...................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKG--PNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGE-RAKDG--RFRQFRQCDIDVVGREKLSLLYDAQ-MPAIITEIFEAVNIGDFVIRINNRKVQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSTGTVYETGGRYEELVGT-----IGEKMPGV---ISIGLTRLISRL-----LKAGILNTLPPTPAQVVVVNMQ---DELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIK 461
36 -28.9002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  11  28...........KSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRT-SNQWLDFWLRHRLQWWRKFAM----------------SPSNFSSSDCQDEEGRKGNKLYYNFPWG-----------------------------------------ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTELKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLI 459
37 -28.6004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  6...............................................RAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAE-RPQKG--RYRQFHQVNYEALGSENPILDA---EAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPADYYVRTAFEVHHEEIGAQSALGGG-FAFGVERVALALEAEG------FGLPEEKGPDLYLIPLT---EEAVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLL 419
38 -28.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  15...............................................KTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL--MGKYGEDSKLIYDLKDQGGELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRRI-RTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTTGVIYEAGGRYDGLVGM-----DPKGRKVPCVGLSIGVERIFSIVEQRLEALEE---KIRTTETQVLVASAQ---KKLLEERLKLVSELWDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIK 457
39 -28.4004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  8LLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEAEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLRLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRT-SNQWLDFWLRHRLQWWRKFAM----------------SPSNFSSSDCQDEEGRKGNKLYYNFPWG-----------------------------------------ELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTELKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLI 452
40 -27.2002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  16  13...............................................QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHE-RPQKG--RYRQFHQLGCEVFGLQGPDIDA---ELIMLTARWWRALGISHVTLELNS-----IGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLEAGIAYTVNQRYNRTVFEWVTNSLGSQGTVCAG-FAMGLERLVLLVQAVN------PEFKADPVVDIYLVASG---ADTQSAAMALAERLRDPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLR 427
41 -26.8001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  11  1.........WLSGYAGPADGTQQPDAPEHAVAREALVDLCRRRHFLSGTPSGCHAFGPLGVELRKNLASQWWSSMFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIRLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEASLVWFTPTRT-SSQWLDFWLRHRLLWWRKFAMSPSNFSSDCQDELGRKGSKLYYSFPWGKEPI---------------------------------------------------------ETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAELKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLV 434
42 -25.9005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  7...............................................VAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRADATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYE-KPQKG--RYRQFHQFGVETFGVATPDIDA---ELIMLTARLWKRMGVHMVQLELNTGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAARGLDYKTVFEWGGRYDGLVG-QLKGKADQSVPAV---FAMGMERLLLLLEQVE-----------QAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSN-SQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLI 427
43 -25.9005c53_B mol:protein length:903 Pol gamma B  ali model follow..  10  371..............NELLENGISVWPGYLETMQSSLEQLYSKYDEMTTLENGLIHLRSRDTTMISKLKDFLIKYISRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPDSAFRLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRT-SNQWLDFWLRHRLQWWRKFAMSPSNFSSDCQDEEGRKGNKLYYNFPWGKELI---------------------------------------------------------ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTELKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLI 894
44 -25.8004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  1..............MAMGTLEAQTQGPGSMTEQKRKLEKL-------TGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGEVTDIVEKEMYSFVDANGENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHE-RPQRG--RYRQFHQVGVEALGFAGPDADA---EIVMMCQRLWEDLGLTGIKLEINS-----LGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKNNVPFTINPRYNLTVFEWVTDKLGAQGTVAAG-WAMGIERILELLKEEHLVPEQ-------EGVDVYVVHQG---DAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLI 449
45 -25.3003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  11  164..............................VRKKYSHVDLVVM--AVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVRDTRGIFRVHQFEKIEQFVYSSPHNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKEAWFPGSGAFRELVSCSNCT---------------------------------------------------------DYQ-----ARRLRIRYGQTKKMMDKVMLNATMCATTRTICAILENYQTEKGITVPEKLKEF--LQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEV.......................................... 511
46 -24.7003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  14  226.................NREIKRVGGPPEFSFPPLDHVALMEKNGWWESGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI---AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASLEASRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWREVYLPSEGRYRETHSCSALL---------------------------------------------------------DWQ-----ARRANLRYRDPEGRVRYATLNNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................ 520
47 -24.7003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  40..........KGGHVKSHAELEGNGEHPEAPGSGEGSEALLEISRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP----------------LLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWFTPPRT-SNQWLDFWLRHRLQWWRKFAMSPSNFSSDCQDEEGRKGNKLYYNFPWGKELI---------------------------------------------------------ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTELKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLI 444
48 -24.4003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  13  163.VEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVCPPKRDGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIEHVWIAEPEEA-YRIRRELLEATKRVAEELELEWKVVVSD-----------------------------------------DPFYLEGRLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEHFVDGFNV----KEKSGRTLFTGCAGLGVTRWVVGLLAQHGFYPY-EWPEPI............................................................................................... 505
49 -24.0003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  13  152...........AQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSG-DGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEARDTLGIFRVHQFDKIEQFVVCSPREESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKEAWFPASGAFRELVSCSNCT---------------------------------------------------------DYQ-----SQSVNCRYGPNLRGTAA-MLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPY............................................................................................ 460
50 -23.8002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  14  116...........GEDEKDNVEVRRWGEPRKFDFEPKPHWEIGER--AKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCER---DNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAKDIRGIIRQHQFDKVELVKIVHPDT-SYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKEVWFPSQNKYREISSCSNCE---------------------------------------------------------DFQ-----ARRMNTRFKDSKTGKNRFVLNGSGLAVGRTLAAILENYQQEDGVVVPEVLRDY............................................................................................ 416
51 -23.7001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  16  154................................................SGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAE---TDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWREVYLPSEGRYRETHSCSALL---------------------------------------------------------DWQ-----ARRANLRYRDPEGRVRYATLNNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................ 411
52 -23.5002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  13  156..............................EWKPKLHVDLLEI--AKVSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV---EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAKDTKGIFRVHQFHKVEQFVYSRPEE-SWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKEAWMPGQGKFREVVSASNCT---------------------------------------------------------DWQ-----ARRLNIRFRDRTDEKPRYVLNSTAIATSRAIVAILENHQEEDGVRIPKVLWKY............................................................................................ 437
53 -23.4006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  12  179..............................GYKCLKHIDIMRKLGGLATEEGTYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVTG-EGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVKDTLGIFRVHQFEKIEQFVVTSPKDNKSEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEA---------------------------------------------------------PGADEGNEYRELVSCSNCTDYQTRRLEVKYGKSKKQGSEVMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY............................................................................................ 468
54 -23.2001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  13  176..............................SFQPRGHLEIAEK--SHVSGHRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNIDPRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETKEPWGLYRVHHFTKVEMFGVTGPGEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYREAWMPGRGRFGEVTSASNCT---------------------------------------------------------DFQ-----SRRLHIMFQTEAGELQFATVNATGCAVPRLLIALLESYQQKDGVLVPPALQPY............................................................................................ 461
55 -23.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  11...............................................EKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVS--AILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQ-QNEGG--KPAEFEQLGVELIGDGTASAD----EVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTTGVVFEGGGRYD-----ELLSKFHRPAQAT---FGVRIDLLVEALNGEIIS----------NGHEQTCILF---SNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA......................... 400
56 -22.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  3.......ALTKSQTDRLEVLLNPKDEISLNSGKPFREL---ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSCMVFG........................................................................................................................................................................................................................................... 199
57 -21.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS-LLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDF...................................................................................................................................................................................................................................................... 205
58 -21.5001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  12  7.....................................................................................................................................................................................................................................................................................................................................................................GPVDCSVIVV---NKQTKDYAESVGRKVRDLGMVVDLINTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVA 102
59 -21.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  14  3.....GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLVFWQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSCMVFGDTLD....................................................................................................................................................................................................................................... 217
60 -20.3004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  13  2.......ALTKSQTDRLEVLLNPKDEISLNSGKPFREL---ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFFQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSCSVYG........................................................................................................................................................................................................................................... 198
61 -19.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  5............TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLAFAQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSCMVYG........................................................................................................................................................................................................................................... 199
62 -19.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  10  18..........TRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMT--IGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDK-PIRIFEIGTCYRKESQGAQ---HLNEFTMLNLTELGTPLEERHQ---RLEDMARWVLEAAGIREFELVTES............................................................................................................................................................................................................................................... 227
63 -18.9002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  14.HMASAPALTKSQTDRLEVLLNPK--DEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSC............................................................................................................................................................................................................................................... 212
64 -17.6002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  14...............................................................................................................................................................................................................................................................................................................GERVRGLKQQELIEEEVAKLLKLKAQLGESKQKFVLKTPKALEE------KIRTTETQVLVASAQ---KKLLEERLKLVSELQDAGIKAELLKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIK 160
65 -17.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  13  14.HMASAPALTKSQTDRLEVL-LNPKDEISLNSGKPFRELESE--LLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG--IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLSFIQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSC............................................................................................................................................................................................................................................... 212
66 -16.8003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  2.........................NAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRA---PESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTLSWASG--KAAESTQVGIERIGEEASVDVDM--DVLRLLHEASAAAGVRHHRIVVSH............................................................................................................................................................................................................................................... 188
67 -15.8006FTT Entity 1(prereleased)  ali follow..  12  3................................................LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESL-LSGASEDLKRQTFKIIDQTGRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAAD----ELIDVLFSMINSLDMSVLHVDLGHVTIFKRLAELAALSASDTEQQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHGIVFNGGGRFDGMKSN--QLATNQPRQAT---FSMDVSRLLAHTQLDA-----------PFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPDMPVGLTHRLSLADNQWRLHAV................................... 388
68 -15.8005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  3................................................LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESL-LSGASEDLKRQTFKIIDQTGRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAAD----ELIDVLFSMINSLDMSVLHVDLGHVTIFKRLAELAALSASDTEQQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHGIVFNGGGRFDGMKSN--QLATNQPRQAT---FSMDVSRLLAHTQLDA-----------PFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPDMPVGLTHRLSLADNQWRLHAV................................... 388
69 -15.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  20..................................................EESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTASNGKTFNQEKMFQFIKHEGQSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKE-KRHKG--RSTENYQIGIELFGESADKSE----EILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSETDLMFKAGGRYD-----QLLSNFQEEAFAI---FCCHMDTILKALERQELEED....................................................................................................... 336
70 -11.9001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  4..............................................................LDFEKVFSFYSKATKKGFSPFFVPALEKAEEPA-----------GNFFLDRKGNLFSIRE---DFTKTVLNHRKRYSPDSQIKVWYADFVYRYSGS------DLVAEYQLGLEKVPRNSLDDS----EVLEIIVESASEFFEGPVIVEIGH............................................................................................................................................................................................................................................... 131
71 -10.4003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  17............................................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQA---VTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNE---EMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERKGIELANGFH--QRFEQPIDQNLLDALAAGLPDCSG-VALGVDRLVMLALGAESLADVIAFTVDRA.............................................................................................. 326
72 -10.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  13  4..................................SSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATV--TDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG-------PVFQLCRSFRNE---EMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERKGIELANGFH--QRFEQPIDQNLIEALKVGMPDCSG-VALGVDRLVMLALGAETLAEVIAFSVDRA.............................................................................................. 339
73 -9.8104j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  210............................................................FRLQSGICHLFRETLINKGFVEIQTPKIISAA--------SEGGANVFTVSYFKNNAY-------------LAQSPQLYKQMCIKVFSIGPVFRAEDSNTH---HLTEFVGLDIEMAFNYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQ-PQLLTERALHHGIDLEKIKAYIDSAGGGIGLERVTMLFLGLHNVRQTSMFPRDLTP............................................................................................. 515
74 -9.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13  15............................................................IDIQTKILDYMTKFFTDRGFKWLLPIMLSPIT----------------LWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIKIFVLSPNIRLESRRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEM----EEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLK-----EDSFRPYLEIA---RAGKLKP---AGAGIGVERLVRFIVGAKHIAEVQPFP.................................................................................................. 285
75 -9.1601nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  12  15............................................................LDIQTKILEYMTDFFVKEGFKWLLPVIISPIT--PLWPDPAGEGMEPAEVEIYGVKMR-------------LTHSMILHKQLAIKIFVLSPNIRLESRQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEM-------------EEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFR--YLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPR--IPGIPAVI....................................................................................... 294

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.