current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2k50_A mol:protein length:115 Replication factor A related protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
3 -41.1002k5v_A mol:protein length:104 Replication protein A  ali model follow..  19  3.......YKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELAD--FEVKKGDIAEVSG----KQGYSGLEISVDNIGIIEKSLE.. 98
4 -39.3003e0e_A mol:protein length:97 Replication protein A  ali model follow..  20  2......NYKISELMPNLSGTINAEVVTAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELAD--FEVKKGDIAEVSG----KQGYSGLEISVDNIGIIEKS.... 96
5 -36.4002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  21  3.......EKVGNLKPNMEVNVTVRVLEASEARQIQTKNG-VRTISEAIVGDETGRVKLTLWGKHAGS---IKEGQVVKIENAWTTA-FKGQVQLNAGSKTKIAEASEDG 100
9 -33.3002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  19  2.....DLVKIRDVSLSTPVSVIGKITGIHKKE--YESDGTTKSVYQGYIEDDTARIRISSFGKQ------LQDSDVVRIDNARVAQ-FNGYLSLSVGDSSRIESVNV.. 95
10 -31.8002kbn_A mol:protein length:109 Conserved protein  ali model follow..  15  2...EPQLTKIVDIVENGQANLKAKVIQLWENTH-------ESISQVGLLGDETGIIKFTIWKNAEL--PLLEQGESYLLRSVVVGE-YNDRFQVQVNKNSSIEKLSE.. 96
11 -28.0002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  17  2.....SHMQVTPRRNVQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNT--SLKEKFNGKKIIIISDYLEYDS-----LLEVNEESTVSEAGPNQ 99
12 -25.0004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  20  99.....RISKLKIQPCGTIVNGLFKV----------QKITEEKDRVLYGIHDKTGTMEVLVLGNPSKT--KCEEGDKIRLTFFEVSK-NGVKIQLKSGPCSFFKVIKAAK 189
13 -24.9004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  14  3.....TETFVKDIKPGLKLNLIFIVLETGRVTKT----KDGHEVRTCKVADKTGSINISVWDDVGNL---IQPGDIIRLTKGYASV-FKGCLTLYTGRGGDLQKIGE.. 97
14 -24.1003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  18  1.......GSVDSIREGQKRCLPVMVLKAKKPFTFETQEG-KQEMFHATVATEKEFFFVKVFNT--LLKDKFIPKRIIIIARYYRHSG-----FLEVNSASRVLDAESDQ 95
17 -21.7004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  19  105DERPIEHLKICDLHLQTEERLVDGEFKV-------YRKSSGNNCICYGIWDDTGAMKVVVSGQLTSV--NCEIGNTIRLVCFELTS-NADEWFLRATRYSYMEVIMPEK 203
19 -18.6004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  19  109.KETLKISKIKELDSGTLIYGVFAVEKKK----------VNDKSITFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSFHLRK-GNGKPILHSGNHSFIK...... 197
20 -17.9003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  16  6.ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPY----LSKGTDYCSVVTIVDQTNVLTCLLFSGNYEALPIIKNGDIVRFHRLKIQV-YKKETQGITSSGFASLTFEGTL 110
21 -17.4004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  18  105IRSAKETLKISKIKELDSGTLIYGVFAV-------EKKKVNDKSITFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSFHLRK-GNGKPILHSGNHSFIKG..... 198
22 -17.3004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  18  105.KETLKISKIKELDSGTLIYGVFAVEKKKVND----------KSITFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSFHLRK-GNGKPILHSGNHSFIKGEK... 196
23 -17.3004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  13  123.....RINELESVEANQQCDVIGILDSYGELSEIVSKSQRPVQKRELTLVDQGNSVKLTLWGKTAETFPT-DEKPVLAFKGVKVGD--FGGRSLSMFSSSTMLINPDIT 229
25 -16.1004hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  19  1..MSDSFSLLSQITPHQRCSFYAQVIKTW----------YSDKNFTLYVTDYTENIRCILWDEHDFYCNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSSIEKVDSEE 127
26 -15.7001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  12  26.ELTFQSIRSSQEKKNTIVNLFGIVKDFTPSR--QSLHGTKDWVTTVYLWDPT-GLQIHLFSKQGNDLPVIQVGQPLLLHQITLRS-YRDRTQGLSKDQFRYALWPDFS 138
27 -14.5003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  11  56................AAVWMQGRVVMADR--------------GEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGV---QACSPEPCLQAVKMTDLSDNPIHE 132
28 -14.2003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  10  59................AAVWMQGRVVMADRG--------------EARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMG----QACSPEPCLQAVKMTDLSDNPIHE 135
29 -13.9001jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  16  33.GHKYEYVELAKASLAQPQHFYAVVIDATFPY----KTNQERYICSLKIVDPTDYATLVLYAKRFEDLPIIRAGDIIRVHRATLRL-YNGQRQFNANVFYS........ 143
30 -11.4004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  15  37................GQLTFVAVVRNIS----------RNATNVAYSVEDGTGQIEVRQWSDDSSKASEIRNNVYVRVLG----KSFQNRRSISSGHMRPVIDYNEV. 120
31 -11.4004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  20  37................KQVDVLGTVIGVRERDAFYS----------YGVDDSTGVINCICWQETIEQKTKIEIGDTIRVRG----RTYREEREIHATTYYKVD...... 138
33 -10.6003kf8_A mol:protein length:220 Protein stn1  ali model follow..  84..............PVNQINIFGKIVYEQYKEKEFNGVEESYVI--LVISDFIGIDSKIRVRLSQEQFDKKNYGKIVELEGE---YNWYDSINVSKKPDRELKV..... 176
34 -10.6001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  10  27.....TVESAKSLRDDTWVTLRGNIVERISDDLY-------------VFKDASGTINVDI-DHKRWNGVTVTPKDTVEIQG----DKDWNSVEIDVKQIRKVN...... 108
35 -10.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  11  48................RWIQIVGYIAAIDIYEGKHV----------LTVDDCSGMVLRVVFFSMSKRAISMSPGNVVCVFGK---NSFRSEVELIAQSFEELRDPNDE. 132
36 -10.5002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  11  49.......CTISQLLS-SQVTIVGIIRHAEK----------APTNIVYKIDDMTAAPMDVRQDDTSSENTVVPPETYVKVAG----RSFQNKKSLVAFKIMPLEDMNEF. 155
37 -10.2004gla_C mol:protein length:109 OBody NL8  ali model follow..  19  13........EITPNLHGTEVVVAGWVASLGD----------YGRVKIVKVSDREGGAAVPV-DHLFKVFAELSREDVVVIKGVEASKGVGRGVEIFPSEIWILNKAK... 108
38 -9.7506bwy_A mol:protein length:361 Protection of telomeres protein 1, DNA dC->dU-editing enzyme APOBEC-3G fusion  ali model follow..  11  29.......SSQELQKKNTIVNLFGIVKDFTPSR--QSLHGTKDWVTTVYLWDPTIGLQIHLFSKQGNDLPVIQVGQPLLLHQITLRSYRDRTQGLSKDQFR......... 125
39 -9.5801x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  18  1MIEKVYCQEVKPELDGKKVRLAGWVYTNM----------RVGKKIFLWIRDSTGIVQAVV-EETFEKAKKLGRESSVIVEGIVKADRAPGGAEVHVEKLEVIQAVSE.. 103
40 -9.2903rln_A mol:protein length:200 Gamma-interferon-inducible protein 16  ali model follow..  14  80.....PFTLVADVNADRNMEIPAGLIASASVTPEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTI--NCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRK 199
41 -9.1903rlo_A mol:protein length:204 Gamma-interferon-inducible protein 16  ali model follow..  14  80.....PFTLVADVNADRNMEIPKGLIRSASVTPEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTI--NCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKT.. 197

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.