current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2k5v_A mol:protein length:104 Replication protein A, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
4 -41.1002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  19  8..DTISKLEEGAETPVTGRVMKISSPRTFTTRKGREGKLANVIIADDTGELRAVFWTENIKKKFREGDVIRIKD--GGFGGRKEAHLMPRSTVEVLDP 107
5 -38.7002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  20  1MEEKVGNLKPNMEVNVTVRVLEASEARQIQTKNG-VRTISEAIVGDETGRVKLTLWGKHAGS-IKEGQVVKINAWTTAFKGQVQLNAGSKTKIAEASE 98
7 -37.2001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  21  17..VKVEQLKPGTTHTLTVKVIEANIVVPVTRRPSQPSRIVECLIGDETGCILFTARNDQVDL-MKPGATVILNSRIDMFKGTMRLGVDKWGRIEATGA 122
9 -34.7002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  20  4..VKIRDVSLSTPVSVIGKITGIHKKE--YESDGTTKSVYQGYIEDDTARIRISSFGKQ----LQDSDVVRINARVAQFNGYLSLSVGDSSRIESVNV 95
10 -34.5002kbn_A mol:protein length:109 Conserved protein  ali model follow..  21  6..TKIVDIVENGQANLKAKVIQLWENT-------HESISQVGLLGDETGIIKFTIWKNAELPLLEQGESYLLSVVVGEYNDRFQVQVNKNSSIEKLSE 96
11 -29.8002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  5...QVTPRRNVQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDS---LLEVNEESTVSEAGP 97
12 -26.2003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  10  2...SVDSIREGQKRCLPVMVLKAKKPFTFETQEG-KQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSG---FLEVNSASRVLDAES 93
13 -26.1004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  14  99...RISKLKIQPCGTIVNGLFKV-------QKITEEKDRVLYGIHDKTGTMEVLVLGNPSKTKCEEGDKIRLTFEVSKNGVKIQLKSGPCSFFKVIKA 187
15 -22.6004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  13  113...KICDLHLQTEERLVDGEFKVYRKSS-------GNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCELTSNADEWFLRATRYSYMEVIMP 201
16 -20.9001ynx_A mol:protein length:114 Replication factor-A protein 1  ali model follow..  25  5..FAIEQLSPYQVWTIKARVSYKGEIKTWHNQRG-DGKLFNVNFLDTSGEIRATAFNDFATKFLQEGKVYYVKPQFTNLTHPYELNLDRDTVIEECFD 111
17 -19.6004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  22  111.TLKISKIKELDSGTLIYGVFAVEKKKV-------NDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK.... 197
19 -19.0004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  22  113...KISKIKELDSGTLIYGVFAV-------EKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIKG... 198
20 -18.3004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  22  109...KISKIKELDSGTLIYGVFAVEKKKV-------NDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIKGEK. 196
22 -15.2004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  27  4..YPIEGLSPYQRWTIKARVTSKSDIRHWSNQRG-EGKLFSVNLLDDSGEIKATGFNDAVDRFLQENHVYLIKKQFSNLQNEYEITFENSTEIEECTD 110
23 -14.7003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  12  12..TPLNQLKGGTIVNVYGVVKFFKPPYLSKGTD-----CSVVTIVDQTNVLTCLLFSGNYEALYKNGDIVRFHRKIQVYKKETQGITSSGFAS..... 103
24 -14.6004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  18  37...........KQVDVLGTVIGVRERDAF----------YSYGVDDSTGVINCICWKKLNTESIEIGDTIRVRGSIRTYREEREIHATTYYKVD.... 138
25 -14.6003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  13  56...........AAVWMQGRVVMADRG--------------EARLRDPSGDFSVRGLERVPRGRLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPI 130
26 -14.4004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  16  37...........GQLTFVAVVRNIS----------RNATNVAYSVEDGTGQIEVRQWLDSSSDDIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNE 119
27 -14.3003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  13  59...........AAVWMQGRVVMADRG--------------EARLRDPSGDFSVRGLERVPRGRLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPI 133
28 -14.0003kf8_A mol:protein length:220 Protein stn1  ali model follow..  15  84.........PVNQINIFGKIVYEQYKEKEFNGVEESYVI--LVISDFIGIDSKIRVRLSQEQFKNYGKIVELEGEIYNWYDSINVSKKPDRELK.... 175
29 -13.8002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  15  47VPCTISQLLSATQVTIVGIIRHAEKAPT-----------IVYKIDDMTAAPMDVRQWVDTDDTVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNE 154
30 -13.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  15  46.........PIRWIQIVGYIAAIDIYEGKHV----------LTVDDCSGMVLRVVFIIQDDFSMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPND 131
31 -13.4001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  20  30...SAKSLRDDTWVTLRGNIVERISDDLY-------------VFKDASGTINVDIDHKR-GVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVN.... 108
32 -12.7006d6v_D mol:protein length:701 Telomerase-associated protein 82  ali model follow..  360..QKNNKYRQNNNSEVLKTSKQYLSVLAVVDIQSSDKNIRLKICDNSCNELKVVIFPDLCYEKFSINKWYYFNEVRQIYNDEVQLKNNIHSSIKESDD 469
33 -12.6001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  11  32IRSSQELQKKNTIVNLFGIVKDFTPSRQ--SLHGTKDWVTTVYLWDPT-GLQIHLFSKQGNDLKQVGQPLLLHQTLRSYRDRTQGLSKDQFR...... 130
34 -11.4001jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  13  39..VELAKASLAQPQHFYAVVIDATFPYKTNQER-----ICSLKIVDPTDYATLVLYAKRFEDLHRAGDIIRVHRTLRLYNGQRQFNANVFYS...... 143
35 -9.7904gla_C mol:protein length:109 OBody NL8  ali model follow..  18  13...EITPNLHGTEVVVAGWVASLGD----------YGRVKIVKVSDREGGAAVPVYLEAGKAELSREDVVVIKGIVEASKRGVEIFPSEIWILNKAK. 108
36 -9.7604hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  21  8....LSQITPHQRCSFYAQVIKTW----------YSDKNFTLYVTDYTENIRCILWDEHDFNYIKEGDYVVMKN........................ 93
37 -9.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  1MRVLVRDLKAGQEVELLGFLHWRR----------DLGRIQFLLLRDRSGVVQVVT---GGLKLPLPESALRVRGLVVENAGGLEVQAKEVEVLSPALE 90
38 -9.0202wkc_A mol:protein length:119 ORF34P2  ali model follow..  15  8..................AQANEKNTRTVSTAKGDKKIIS--VPLFEKEKGSNVKVAYGSADFIQLGDTVTVSGRVQA.................... 68
39 -9.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  18  4.KVYCQEVKPGKKVRLAGWVYTNM----------RVGKKIFLWIRDSTGIVQAVVAKNVVGEELGRESSVIVEGIVKADEGGAEVHVEKLEVIQAVSE 103

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.