current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSISLast
1 -77.2002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model  100  1AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS 170
2 -52.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  70  358AGEEPLGVGSVAAGGRYDGLVGMFDPKGRK----------VPCVGLSIGVERIFSIVEQRLEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL... 517
3 -51.4004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  70  305AGEEPLGVGSVAAGGRYDGLVGMFDPKGRK----------VPCVGLSIGVERIFSIVEQRLEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL... 464
4 -49.5003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  26  316..IGHEALGSICSGGRYEELVGTFIGEKMPG------------VGISIGLTRLISRLLKAGINTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKR-QLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT...... 465
5 -48.1001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  16  279..DRSGQFRAILGGGRYDNLASLMSGESVPA------------VGFGMGDAVISLLLKRENVQI-PREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMER-GLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLE.... 428
6 -48.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  21  275..NYDGAITTLCGGGRYNGLLELLDGPSETG------------IGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQR-KIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK......... 420
7 -47.5003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  300..DREGKFRALCGGGRYDNLLTTYGSPT------------IPCAGFGFGDCVIVELLQEKRLLPDIPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKK-KVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL......... 446
8 -47.4002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  281..NSLGSQGTVCAGGRYDGLVEQLGGRATPA------------VGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDPGVKLMTNHGGG-NFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG...... 431
9 -47.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  300..DRDGNFRALCGGGRYDNLLTTYGSPT-----------AVPCVGFGFGDCVIVELLNEKKLLPELHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKK-KVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPVD........ 447
10 -47.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  16  276..EEIGAQSALGGGGRYDGLSELLGGPRVPG------------VGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYALAPR-KPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG...... 423
11 -46.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  16  277..TALGSQGTVCAGGRYDGLVGQLKGKADQSV---------PAVGFAMGMERLLLLLEQVEQAE--IVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK..... 432
12 -46.6004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  295..DKLGAQGTVAAGGRYDPLIEQLGGKPTAA------------CGWAMGIERILELLKEEHLVP-EQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMVATAE.. 457
13 -29.2003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  292........VPLCSGGRYDELLSKFHRP-------------AQATGFGVRIDLLVEALNGEII----SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAG-VTDVDAMSSNYQDVIYCIGTAGRGGEDA................................... 400
14 -22.0001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  13  5.................................................................SSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYER..... 107
15 -21.6006FTT Entity 1(prereleased)  ali follow..  11  278.....SETQPLVRGGRFDGMKSNQLATNQPR----------QATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDGLTHRLSLADNQWRLHAV............................................. 388
16 -21.6005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  278.....SETQPLVRGGRFDGMKSNQLATNQPR----------QATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDGLTHRLSLADNQWRLHAV............................................. 388
17 -19.9004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  278................................................SVERMIAILTEGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRS... 398
18 -19.8004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  252..................QLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTEGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRS... 402
19 -19.4005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  19  393..............................................................................LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV. 485
20 -19.2002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  19  376..............................................................................LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV. 468
21 -19.0003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  19  360.............................................................................TLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV. 453
22 -18.8004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  19  368.............................................................................TLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNVA 462
23 -18.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  13  317...................................................................ACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED..... 424
24 -18.6001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  17  351..............................................................................VELRQVCQGLLNELLENGISVGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASNVA 444
25 -18.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  15  517................................................SMERFIGILTEAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRS... 636
26 -18.5005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  14  294...................................................................APVQVIIIPIIEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEE..... 397
27 -18.4004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  14  237.............GTNFAKMFKI----EFEDENEVKQYVHQTSWGCTTRSIGIMIMTDKGLVLPPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVD..... 393
28 -18.3001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  334...................................................................APIKVAVIPLRPEITEYAKRLKARLLALGLGRVLY-EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR...... 441
29 -18.2005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  13  260.............................................WGCTTRSLGVMIMTHGDDPPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLET..... 390
30 -18.1005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  19  233.............GTNFAKMFEI----EFEDEEGHKRLVHQTSWGCTTRSLGVMIMTDKGLVIPPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEG..... 389
31 -18.1004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  273..........................................SWGLTTRTIGVMTMVNMGLVLPPRVACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED..... 408
32 -18.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  15  278................................................SMERFIGILTEAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRS... 397
33 -18.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  20  307...................................................................AAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLD-DRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKD..... 408
34 -17.9005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  17  260.........................................NSWGLS---TRVIGVMNRGMVMPPRVASTQVIIIPVGQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQ 401
35 -17.7001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  13  519.........................................GVVS---TMERFVAFLTEKGAFPTWLAPKQVQIIPVNVDLHYDARQLQDELKSQGVRVSIDDRNE-KMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKK... 643
36 -17.6002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  11  304.............GTKYSDSMKA----NVTGPDGTDAPIHGGSYG--VGVSRLLGAIIEACHDPEAVAPFRVTILNLKAATDAACDQLYRELSAKGVDVLYD-DTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.......... 452
37 -17.4005c53_B mol:protein length:903 Pol gamma B  ali model follow..  19  810.............................................................................TLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV. 903
38 -17.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  286..................NLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLERGRMPFTLAPIQFAVIAVKTGIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLA... 443
39 -16.9001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  19  286...................................................................APIQVVIVPIYKDESRERVGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLAS-RLGGKETLPLAALPEALPGKLDA..... 387
40 -16.3005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  15  418.............GTKYSEAMKL----SVLSEQGKPVNLIMGCYG--IGVSRVVAAAIEQNHDPSALAPFQIALVPLKESVKQATDKLYAELTAAGFEVLLD-DKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR..... 573
41 -16.3002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  12  521...........................................IEPSFGLGRIMYTVFEHTFHVREGDEQRVLPLSQNQEFMPFVKELSEALTRHGVSHKVD-DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGNIT.. 661
42 -15.9001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  16  281...................................................................APIQVVIVPLIEDIVMEKAKEIYEKLKGKFRVHID-DRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNN..... 381
43 -15.4003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  266............................................GISTRVLACALSISGGLVLPPLIAPIHVVIIPIGQQVLGKVNEIADTLSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVRDVGKDQKRVIPITEVMKVSSHTTENHEL.. 405
44 -15.0001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  13  406.........................................................................LVKNRPEITEYAKRLKARLLALGLGRVLY-EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR...... 504
45 -15.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  12  415.............GTRYSDAMGA----TVLDENGREKSVIMGCYG--IGVSRLLSAIVEQNADPTGIAPFDLHVVQMNEYQTKLSQEVEAMMTEAGYEVLVD-DRNERAGVKFADADLIGCPIRITVGK-KAVDGVVEVKIKRTGEMLEVRKEELESTLSILMNT..... 567
46 -13.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  10  317................................................SIERFMALLIDEGRWPFWLNPYQAVIIPVNTKNVQQLDMCPVPLNDWHFNVDLDIRNE-PVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEKNYK... 454
47 -12.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  328........APIAQGGRYDELLAQFGAG-------------APAVGFAFEVERVMAVLEAQEEGEGEC....................................................................................................... 373
48 -11.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  290.....AANQPILSGGRYDQLLSNFQEE-------------AFAIGFCCHMDTILKALERQELEEDND....................................................................................................... 338

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.