current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2pi2_E mol:protein length:142 Replication protein A 14 kDa subunit, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MGSSGHIEGRHMVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHDLast
1 -75.8002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model  100  1MGSSGHIEGRHMVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD 132
2 -52.9004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model follow..  24  1...............MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGN--TLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIRE-DCGHDVDLTLVENVVQISAAFPNLFSDST.... 114
3 -49.2006d6v_F mol:protein length:121 Telomerase holoenzyme TEB heterotrimer Teb3 subunit  ali model follow..  20  3............AEQEQVMYPRILFEQMAQFRGKKVTVVGNVCNEDQNDSLVIEFGPTGLNQHVVIDNVDLNNTTKFVEIRGVVLNQNIVSCEELTEF-EQKDPFDFDTYSKLIHLSQKLSSLFTDQ..... 121
4 -20.9004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  15  22................................GSTLRTFGRLCLYDMIQSRVTLMAQHGSDVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQ.......... 116
5 -18.1003kf6_B mol:protein length:105 Protein ten1  ali model follow..  13........................NQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSA----VGINLPRYRQMVSERQKCD........... 105
6 -11.8004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  14........................AEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMGVEIFPSEIWILNKAK........... 113
7 -11.5004gla_C mol:protein length:109 OBody NL8  ali model follow..  12........................AEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGR-GVEIFPSEIWILNKAKA.......... 109
8 -11.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  10........................AEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVA--GVEIFPSEIWILNKAKPL......... 110
9 -11.1004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  11........................AEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYG--GVEIFPSEIWILNK............. 107
10 -10.9003kf6_A mol:protein length:159 Protein stn1  ali model follow..  10  21......MFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDNDEWKAWQKRMRYKKNLTKI......... 149
11 -10.8004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  10........................AEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRDTGVEIFPSEIWILNK............. 106
12 -10.3004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  13  37.................................KQVDVLGTVIGVRERDAFYSYGVDDSGVINCICEQKTKIEIGDTIRVRGSIREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKV............ 159
13 -10.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  13  2.....................RVLVRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRGVVQVVTGGLKLPLPESALRVRGLVPGGLEVQAKEVEVLSPALEPTPVEIPKE.................... 99
14 -9.6303nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  12  56.................................AAVWMQGRVVMADRGEARL----RDPGDFSVRGRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESM--ELEVEDLHRNI......... 146
15 -9.4805gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12........................TEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKGLVQLVCDPSSEVRSEFVLVAKGKVRLRGAGLENPKLKTG------KIEIVLEELIIENK............. 108
16 -9.4303mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  12  59.................................AAVWMQGRVVMADRGEARLR----DPGDFSVRGRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESM--ELEVEDLHRNI......... 149
17 -9.2604gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  12  37.................................GQLTFVAVVRNISRNATNVAYSVEDGGQIEVRQSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVID............................. 116

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 4 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.