current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2w9p_A mol:protein length:87 MULTICYSTATIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLVLast
1 -60.5002w9p_A mol:protein length:87 MULTICYSTATIN  ali model  100  1GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV 87
2 -59.6005kux_A mol:protein length:98 Designed influenza inhibitor protein HSB.2  ali model follow..  65  2GIVNVPNCNTTKYQQLARTAVAIYNYHEQAHLTFVENLNCKEQLGEGDYYYITLAATDDAGKKAIYEAKIGVVESAGWTGVEEFKLV 88
3 -52.6003ul5_A mol:protein length:139 Canecystatin-1  ali model follow..  42  41GDAPAGHENDLEAIELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKVWENFKQLQSFQPV 130
4 -52.3005kuy_G mol:protein length:97 Designed influenza inhibitor HSB.2A  ali model follow..  64  2GIVNVPNCNTTKYQQLARTAVAIYNYHEQAHLTFVENLN---CKEQGNYYYITLAATDDAGKKAIYEAKIGVVESAGWTGVEEFKLV 85
5 -51.5002kxg_A mol:protein length:95 Aspartic protease inhibitor  ali model follow..  19  7GEVIGISVNDPRVKEIAEFALKQHAEQNLILAGVDAGQIIKGIPHWDNYYNLILSAKHSPEFSKFYNVVVLEKASDNSLKLVAFVPL 94
6 -50.7003ima_B mol:protein length:91 Cysteine proteinase inhibitor  ali model follow..  40  4GGIVDVEQNSAEVEELARFAVDEHNKKENALLQFSRLVKAKQQVVSGIMHHLTVEVIEGGK-KKVYEAKVWVQAWLNSKKLHEFSPI 91
7 -50.7004tx4_B mol:protein length:83 Cysteine proteinase inhibitor  ali model follow..  50  1........NSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQK-KVYEAKVWEKPWLNFKELQEFKHV 78
8 -50.2001eqk_A mol:protein length:102 ORYZACYSTATIN-I  ali model follow..  47  11GVEPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAK-KLYEAKVWEKPWMDFKELQEFKPV 96
9 -49.6004n6t_A mol:protein length:79 Adhiron  ali model follow..  60  2........NSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGG-KKKLYEAKVWVKPWENFKELQEFKPV 79
10 -48.1005a0o_B mol:protein length:107 ADHIRON  ali model follow..  47  1.....MASNSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQTPIDTMYYLTLEAKD-GGKKKLYEAKVWVKHIMYYPKTANFKEL 87
11 -47.2005elj_A mol:protein length:116 SUMO-Affirmer-S2D5  ali model follow..  45  6TGVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEYYLTLEAKD-GGKKKLYEAKVWVKGLTNWKLGMNFKEL 98
12 -46.9002l4v_A mol:protein length:135 Cystatin  ali model follow..  44  49..APLNNENGFDKEDLARFAVREYNNKNNALLEFVRVVKAKEQVVSGMMHYLTVEVNDAG-KKKLYEAKVWEQVWMNFRQLQEFTYL 132
13 -46.8005mn2_C mol:protein length:101 Affimer G3  ali model follow..  44  2TGVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQAMLATMYYLTLEAKDGG-KKKLYEAKVWVKNTQWHNAMTNFKEL 94
14 -45.6005elu_A mol:protein length:118 SUMO-Affirmer-S2B3  ali model follow..  45  6TGVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVPVTTMYYLTLEAKDGG-KKKLYEAKVWVKGYLLEELKHNFKEL 98
15 -45.3005ohm_D mol:protein length:116 K33-specific affimer  ali model follow..  45  5TGVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAEMDASKETMYYLTLEAKDGG-KKKLYEAKVWVKMTNNFKELQEFKPV 103
16 -45.0005ml9_B mol:protein length:115 Affimer F4 with specificity for Fc gamma receptor IIIa  ali model follow..  44  5STVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEHWFPGTMYYLTLEAKDGG-KKKLYEAKVWVKNTAAPPSHMNFKEL 97
17 -44.9005ohl_A mol:protein length:116 K6-specific affimer  ali model follow..  42  5TGVRAVNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKDDELFDTMYYLTLEAKDGG-KKKLYEAKVWVKASGIVMYQMNFKEL 97
18 -44.2003l0r_A mol:protein length:115 Cystatin-2  ali model follow..  26  5GGWTRQDPTEARFLELAHFATSSQTEGREFYDTVVTVKEVETQVVAGMNYKLTIEISPSVCKIGTCVAVIYHVPWQNQKSVTSYRC. 108
19 -43.3004lzi_A mol:protein length:282 Multicystatin  ali model follow..  79  194GFTDVPFPNNPEFQDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGK-KKIYEAKIWVKEWEDFKKVVEFKLV 279
20 -40.4001a90_A mol:protein length:108 CYSTATIN  ali model follow..  24  1GAPVPVDENDEGLQRALQFAIAEYNRASNDKSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSTCTFVVYSIPWLNQIKLLESKC. 107
21 -40.4004it7_A mol:protein length:113 CPI  ali model follow..  30  7GGFSTKDVNDPKIQALAGKALQRINAASNDLQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNICTVAIWEKPWENFEEITIKEC. 110
22 -39.9005o46_B mol:protein length:120 Iristatin  ali model follow..  18  5GVWRKHHPVDPRYKEWAHFAISSQVENRTNFDTLMTLISVESQVIAGVDYKLKMKVAESTCVIGLCTAVVNYMPWEHKTILKSYDC. 109
23 -39.7001yvb_I mol:protein length:111 Cystatin  ali model follow..  23  4GAPVPVDENDEGLQRALQFAMAEYNRASNDKSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSTCTFVVYSIPWLNQIKLLESKC. 110
24 -39.5003gax_A mol:protein length:120 Cystatin-C  ali model follow..  17  11GGPMDASVEEEGVRRALDFAVGEYNKASNDMSRACQVVRARKQIVAGVNYFLDVELCRTTCTKTFCSFQIYAVPWQGTMTLSKSTC. 117
25 -39.2001rn7_A mol:protein length:122 Cystatin D  ali model follow..  24  12GGIHATDLNDKSVQRALDFAISEYNKVINKDSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSFCSFQINEVPWEDKISILNYKC. 119
26 -39.1001g96_A mol:protein length:120 CYSTATIN C  ali model follow..  17  11GGPMDASVEEEGVRRALDFAVGEYNKASNDMSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTFCSFQIYAVPWQGTMTLSKSTC. 117
27 -38.5002mzv_A mol:protein length:199 Cystatin  ali model follow..  16  109SGWRPVPVHDPVVQDAAHHAIKTIQERSNSPYELSEVVHANAEVVTSAKFDMLLKVKRGGK-EEKYKVEVHKSTEEGGFNLKKVDL. 196
28 -38.1002ch9_A mol:protein length:131 CYSTATIN F  ali model follow..  18  18GFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNSCYSEVWVVPWLQHFEVPVLRC. 125
29 -37.8004n6m_A mol:protein length:132 Cystatin-M  ali model follow..  20  11GELRDLSPDDPQVQKAAQAAVASYNMGSNSIFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRCDFEVLVVPWQNSSQLLKHNC. 121
30 -37.2004n6l_A mol:protein length:131 Cystatin-M  ali model follow..  20  10GELRDLSPDDPQVQKAAQAAVASYNMGSNSIFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRCDFEVLVVPWQNSSQLLKHNC. 120
31 -35.7003lh4_A mol:protein length:115 Secreted cystatin  ali model follow..  25  8GYRERSNQDDPEYLELAHYATSTWSAQQPGKTHFVEVLKVETQTVAGTNYRLTLKVAESTCELRTCTTVIY-RNLQGEKSISSFEC. 112
32 -35.3003mwz_A mol:protein length:115 sialostatin L2  ali model follow..  22  8GYRERSNQDDPEYLEMAHYATSTWSAQQPGKTTVVEVMKVETQTVAGTNYRLTLKVAESTCELRTCTTVIY-RNMQGEKSINSFEC. 112
33 -33.2001gd4_A mol:protein length:98 CYSTATIN A  ali model follow..  26  4GGLSEAKPATPEIQEIVDKVKSQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDN----KYLHLKVFKSLPGQNEDLV..... 81
34 -33.1001cyu_A mol:protein length:98 CYSTATIN A  ali model follow..  26  4GGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDN----KYLHLKVFKSLPGQNEDLV..... 81
35 -33.0001dvc_A mol:protein length:98 STEFIN A  ali model follow..  26  4GGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDN----KYMHLKVFKSLPGQNEDLV..... 81
36 -32.9002oct_A mol:protein length:98 Cystatin B  ali model follow..  20  4GAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDE----DFVHLRVFQSLPHENKSLT..... 81
37 -32.8001stf_I mol:protein length:98 STEFIN B (CYSTATIN B)  ali model follow..  20  4GAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDE----DFVHLRVFQSLPHENKPLT..... 81
38 -32.6004zm8_A mol:protein length:114 Putative secreted cystatin  ali model follow..  24  5GGYSERANANPEFLNLAHYATSTWSAQQPGKTHFAEVVKVETQVVAGTNYRLTLKVAESTCELRTCTTVVFE-NLQGDKSVSPFEC. 111
39 -26.0004n6v_2 mol:protein length:91 Cystatin-B  ali model follow..  20  6.........TAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDE----DFVHLRVFQSLPHENKPLT..... 74
40 -19.2004ccv_A mol:protein length:115 HISTIDINE-RICH GLYCOPROTEIN  ali model follow..  11  6....DFIEDTEPFRKSADKALEVYKSESEAYFRVDRVERVRVKGGERTNYYVDFSVRNCSRSHFFCRADLSFDVEASNLE....... 91
41 -19.1001n5h_A mol:protein length:105 protegrins  ali model follow..  10  2.....SHMQALSYREAVLRAVDRLNEQSSEAYRLLELDQPKADEDPGTPKPVSFTVKETVCPRKQCVGTVTLDQIKDPLDIT..... 98
42 -18.5004eyc_A mol:protein length:107 Cathelicidin antimicrobial peptide  ali model follow..  2.....SHMQVLSYKEAVLRAIDGINQRSSDAYRLLDLDPRTMDGDPDTPKPVSFTVKETVCPRKRCMGTVTLNQARGSFDIS..... 98
43 -13.3001mnl_A mol:protein length:94 MONELLIN  ali model follow..  23  1GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIRENEREIKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 88
44 -12.9001fuw_A mol:protein length:91 MONELLIN  ali model follow..  23  1GEWEIIEIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIKENEREIKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 88
45 -12.8005xfu_A mol:protein length:94 Monellin chain B,Monellin chain A  ali model follow..  22  2GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIKKTIYEIKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 85
46 -12.4005lc7_A mol:protein length:97 Monellin chain B,Monellin chain A  ali model follow..  21  2GEWEIIDIG-PFTQNLGKFAVDEQNKGKYGRLTFNKVIRPSMK-IKGYEYQLYVRASD-----KLFRADISEDYKTRGRKLLRFN.. 91
47 -12.3005lc6_A mol:protein length:96 Monellin chain B,Monellin chain A  ali model follow..  21  1GEWEIIDIG-PFTQNLGKFAVDEENKGKYGRLTFNKVIRPSMK-IKGYEYQLYVRASD-----KLFRADISEDYKTRGRKLLRFN.. 90
48 -12.0001m9g_A mol:protein length:97 Monellin chain B and Monellin chain A  ali model follow..  23  2GEWEIIDIG-PFTQNLAKFAVDEENKGQYGRLTFNKVIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 91
49 -11.9005o7k_A mol:protein length:96 Monellin chain B,Monellin chain A  ali model follow..  22  1GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIRPCMK-IKGYEYQLYVRASD-----KLFRADISEDYKTRGRKLLRFN.. 90
50 -11.8005z1p_A mol:protein length:97 Monellin chain B,Monellin chain A  ali model follow..  22  2GNWEIIDIG-PFTQNLGKFAVDEANKGQYGRLTFNKVIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 91
51 -11.8002o9u_X mol:protein length:97 Monellin chain B and Monellin chain A  ali model follow..  22  2GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 91
52 -11.7003q2p_A mol:protein length:97 Monellin chain B/Monellin chain A chimeric protein  ali model follow..  23  2GEWEIIDIG-PFTQNLAKFAVDEENKGQYGRLTFNKAIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 91
53 -11.4001iv9_A mol:protein length:96 Monellin  ali model follow..  22  1GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKVIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 90
54 -11.4003pxm_A mol:protein length:97 Monellin chain B/Monellin chain A chimeric protein  ali model follow..  22  2GEWEIIDIG-PFTQNLGKFAVDEENKGQYGRLTFNKAIRPCMK-IKGYEYQLYVYASD-----KLFRADISEDYKTRGRKLLRFN.. 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.