current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2wme_A mol:protein length:490 BETAINE ALDEHYDE DEHYDROGENASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490
# Score Template Links and tools%idFirst MARFEEQKLYIGGRYVEASSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPLAETRSVDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEHPLIEKISFTGGTSTGKKVMASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTDGAFGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVELGDYASVFLast
1 -133.0002wme_A mol:protein length:490 BETAINE ALDEHYDE DEHYDROGENASE  ali model  100  1MARFEEQKLYIGGRYVEASSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPLAETRSVDIVTGADVLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEHPLIEKISFTGGTSTGKKVMASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTDGAFGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVELGDYASVF 490
2 -131.0005fhz_A mol:protein length:529 Aldehyde dehydrogenase family 1 member A3  ali model follow..  41  38.LEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFSPWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAME----DKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP.. 523
3 -130.0004wb9_A mol:protein length:501 Retinal dehydrogenase 1  ali model follow..  38  16.LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWG----NKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS.. 501
4 -130.0001o9j_A mol:protein length:501 ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1  ali model follow..  38  16.IKIQHTKLFINNEWHESVSGKTFPVFNPATEEKICEVEEADKEDVDKAVKAAREAFSPWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKVFASAYLMDLDYCIKALRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKMIQEAAAKSNLKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWG----NKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSALQAGTVWVNCYLAASAQSPAGGFKMSGHGREMGEYGIHEYTEVKTVTMKISEKNS.. 501
5 -130.0001bxs_A mol:protein length:501 ALDEHYDE DEHYDROGENASE  ali model follow..  38  16.LQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVDKAVKAARQAFSPWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYLMDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWG----NKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKISQKNS.. 501
6 -130.0001bi9_A mol:protein length:499 RETINAL DEHYDROGENASE TYPE II  ali model follow..  40  14.LEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLG----RKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS.. 499
7 -130.0001a4z_A mol:protein length:499 ALDEHYDE DEHYDROGENASE  ali model follow..  41  14.PEVLYNQIFINNEWHDAVSKKTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFSPWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCGGGAAA----DRGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS.. 499
8 -130.0004o6r_A mol:protein length:496 Aldehyde Dehydrogenase  ali model follow..  39  3....MQTQLFIDGRFVDAVDRGTIDVLNPHDGSVITKIAAATAADVDLAVDAATRAFPAWSAMPAAERGRLLLRLADAIEANTEALAQLESLDTGHPIRDSRALDVPRTAACFRYFGGMADKLQGSVIPVDTGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPALAAGNTVVLKPSEITPLSTLRIVELMAEVGFPAGVVNIVPGYGHTAGQRLAEHPGVGKIAFTGSTATGRRIVEASQ-GNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQACIAGSRLVLHERIADAFLERFVALASSIRIGNPLDPNTEMGPLTSKQHLDRVLSYVDVAREQGGRVLTGGSAPQDPALANGYYVRPTIVEAKHATDRVAQEEVFGPFVTVLRFGSDDEALAIANATEYGLGSGLWTNDLSRAHRMAARIDAGMCWINCYKRVNPGSPFGGVGKSGYGREMGFEAMHDYTEARSVWVNVDGNV... 484
9 -130.0004x2q_A mol:protein length:504 Retinal dehydrogenase 2  ali model follow..  40  13.LEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLG----RKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS.. 498
10 -129.0005gt6_A mol:protein length:508 Betaine-aldehyde dehydrogenase  ali model follow..  44  26....EEIKMFINGEFVSAIGGKTFETYNPATEDVLAVVCEAQEEDIDAAVKAARSAFGPWAEMTTAERAHLIYKLADLIEEHREELAQLEALDNGKPYQVALDDDISATVENYRYYAGWTTKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYAAKLFKEAGFPNGVVNFVPGFGPEAGAAIVNHHDIDKVAFTGSTVTGKYIMRQSA-EMIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVDALVKMANNVKLGAGMEKETEMGPLVSKKQQERVLNYIEQGKKEGATVAAGGERAL----EKGYFVKPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANNSSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGYKQSGIGRELGSYALDNYTEVKSVWVNIK...... 502
11 -129.0004pxl_A mol:protein length:517 Cytosolic aldehyde dehydrogenase RF2C  ali model follow..  41  26.VEVRFTKLFIDGKFVDAVSGKTFETRDPRTGEVIASIAEGDKADVDLAVKAAREAFGPWPRMTGYERGRILHRFADLIDEHVEELAALDTVDAGKLFAVGKARDIPGAAHLLRYYAGAADKVHGATLKMAQRMHGYTLKEPVGVVGHIVPWNYPTTMFFFKVGPALAAGCAVVVKPAEQTPLSALFYAHLAREAGVPAGVLNVVPGFGPTAGAAVAAHMDVDKVSFTGSTEVGRLVMRAAAESNLKPVSLELGGKSPVIVFDDADLDMAVNLVNFATYTNKGEICVAGTRIYVQEGIYDEFVKKAAELASKSVVGDPFNPSVSQGPQVDKDQYEKVLRYIDIGKREGATLVTGGKPCG----DKGYYIEPTIFTDVKDDMTIAQDEIFGPVMALMKFKTVEEVIQKANNTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYFAFDPDAPFGGYKMSGFGKDMGMDALDKYLQTKTVVTPLYNTP... 509
12 -129.0005l13_A mol:protein length:517 Aldehyde dehydrogenase, mitochondrial  ali model follow..  41  32.PEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAA----DRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS.. 517
13 -128.0004go3_A mol:protein length:495 Putative gamma-hydroxymuconic semialdehyde dehydrogenase  ali model follow..  39  2.....QNQLYIDGRFVDAVAGGTIDVVSPHDGSLITRIAAAEAADVDLAVAAAKRAFPAWSALGAAERGRLLLKLADRIEECSEELAQLESLNTGHPIRDSRGLDVPRTAACFRYFGGMADKIEGSVIPVDAGFLNYVQRKPIGVVAQIVPWNFPLMFTSWKMGPALAAGNTIVIKPSEITPLSTLRIVELMTEVGFPKGVVNVVPGYGHTAGQALAEHLDVGKIAFTGSTATGRRIVEASK-SNLKRIQLELGGKGANIVFEDANIEAAVNGAAWAIFHNQGQACIAGSRLILHKDIADQFLERFIALAKSIRLGDPMDPETEMGPLTSALRRDRVLSYIDIAIEQGGKVLAGGKAPDDKALANGFYVEPTVV-EAKPQDRVCQEEVFGPFVTVVRFSSDEEALAIANNTEYGLGSGLWTQNLARAHKMANAIHAGMCWINCYKRVSPGSPFGGVGQSGYGREMGFEAIHDYTEARSVWVNVDAKI... 481
14 -128.0004q92_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  39  19.LKHLSQRQYIDGEWVESANKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFGEWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYA-DMDDIHNVFMYFAGLADKDGGEMIDSPPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGSIETGKHIMKNAA-NNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTNTNPQL... 505
15 -128.0004pz2_A mol:protein length:534 ZmALDH  ali model follow..  44  39VPEIRFTKLFINGSFVDAVSGRTFDTRDPRTGGVIASVAEADKEDVDLAVRAARAAFGEWPRMSGSERGRIMARLADLVEEHAGELAALESLDAGKHPAVTRAVDVGNAAGSLRYFAGAADKIHGETLKMPGQFQGHTLREPLGVAGVIIPWNFPSTMFAVKVAPALAAGCALVVKPAEQTPLSALYLAQLAKQAGVPDGVINVVPGFGPTAGAALASHMDVDMVSFTGSTEVGRLIMKASAESNLKPVYLELGGKSPLIVFDDADLDMAVELAVGASFFNKGEACVAASRVYVQERVYDRFEERLAERMRSWVVGDPFDPRADQGPQVDKAQYERVLSYIDHGKREGATLLTGGRPCAP--EGKGYYIEPTVFTNVKEDMIIAKEEIFGPVMCLMKFKTVEEAIARANDTRYGLGAGVVTRDLDVANRVVRSVRAGVVWVNCYFAMGSDCPFGGRKMSGFGKDEGMHALDKYLAVKSVVTPLRASP... 526
16 -128.0004mpb_A mol:protein length:520 Betaine aldehyde dehydrogenase  ali model follow..  39  22.LKHLSQRQYIDGEWVESANKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFGEWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYA-DMDDIHNVFMYFAGLADKDGGEMIDSPPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGGIETGKHIMKNAA-NNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTNTNPQL... 508
17 -128.0002d4e_A mol:protein length:515 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase  ali model follow..  41  22.LKERPALHFIAGEFVPSESGETFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMECLDAGQVLRIVRA-QVARAAENFAFYAEYAEHAMEDRTPVDRDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNAA-DHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKGEDLSRGNYLLPTVFVGE-NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTIALPLRPPH... 509
18 -127.0005iuu_A mol:protein length:497 Aldehyde dehydrogenase family protein  ali model follow..  42  19.....EGRAFIQGEYTAAASGETFDCISPVDGRLLAKVASCDAADAQRAVESARSAFGAWSRLAPAKRKATMIRFAGLLEQNAEELALLETLDMGKPISDSLGVDIPGGARALSWSGEAIDKLYDEVAATPHDQLGLVTREPVGVVAAIVPWNFPLMMACWKLGPALSTGNSVVLKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTVVFTGSTKIAKQLMIYAGESNMKRVWLEAGGKSPNIVFADADLQAAADSAASAIAFNQGEVCTAGSRLLVERSIKDRFLPMVIEALGTWKPGNPLDPATNVGALVDTQQMNTVLSYIAAGHTDGARLVAGGKQILQE--TGGTYVEPTIFDGVNNAMRIAQEEIFGPVLSVLTFDTAEEAIQIANDTPYGLAAAVWTANLSKAHLTARALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTWIKL....... 497
19 -127.0006b4r_A mol:protein length:497 KauB  ali model follow..  41  19.....EGRAFVNGEYSNAASGETFDCLSPVDGRFLAKVASCDLADAEQAVKVARNAFGAWSRLAPAKRKQTMIRFADLLLENAEELALLETLDMGKPISDSLHIDVASAANSLRWSAEAIDKIYDEVAATPHAELGLVTREPVGVVAAIVPWNFPLLMSCWKLGPALATGNSVILKPSEKSPLTAIRIAQLAVEAGIPKGVFNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMKRVWLEAGGKSPNIVFADADLKAAAEAAAGAIAFNQGEVCTAGSRLLVERSIKDKFLPLVIEALKGWKPGNPLDPETNVGALVDTQQMNTVLSYIEAGHNDGAKLVAGGKRTLE--ETGGTYVEPTIFDGVTNAMKIAREEIFGPVLSVIEFEDAEEAVRIANDTPYGLAAAVWTSNLSKAHLTAKALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKATWIKL....... 497
20 -127.0004i8p_A mol:protein length:520 Aminoaldehyde dehydrogenase 1  ali model follow..  38  14.AMVPLRQLFVDGEWRPPAQGRRLPVVNPTTEAHIGEIPAGTAEDVDAAVAAARAALRDWARAPGAVRAKYLRAIAAKVIERKPELAKLEALDCGKPYDEAAW-DMDDVAGCFEYFADQAEALDKRQNSPMETFKCHLRREPIGVVGLITPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLELADICKEVGLPSGVLNIVTGLGPDAGAPLSAHPDVDKVAFTGSFETGKKIMASAA-PMVKPVTLELGGKSPIVVFDDVDIDKAVEWTLFGCFWTNGQICSATSRLLIHTKIAKKFNERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKKFISNAKSQGATILTGGVRPA--HLEKGFFIEPTIITDITTSMEIWREEVFGPVLCVKEFSTEDEAIELANDTQYGLAGAVISGDRERCQRLSEEIDAGCIWVNCSQPCFCQAPWGGNKRSGFGRELGEGGIDNYLSVKQVTEYISDEP... 504
21 -127.0003u4j_A mol:protein length:528 NAD-dependent aldehyde dehydrogenase  ali model follow..  40  21....SRYQMLVDGKSVDAASGSTIDRVSPGAGEVVGTWPEASADDVRKAVAAARKAFGPWPRMSGAERSRLMFKVADLILARQEELALIESLEVGKPIAQARG-EIGFCADLWSYAAGQARALEGQTHNNGDDRLGLVLREPVGVVGIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREAGIPDGVFNVVTGYGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAA-RTVKRVGLELGGKGPQIVFADADLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTKIGAMISEAHAEKVHSYVTAGITSGAELLLGGERIG---REAGLYYAPTVFAGVTPDMSIAREEIFGPVLSTLTFKTADEAVALANATEFGLSASVWSTNLETALQTIRRIRAGRCWINSVIDGTPELPIGGYKKSGLGRELGRYGFDEYSQFKGVHVTLGRPAPWF 505
22 -126.0005kj5_A mol:protein length:520 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  36  29.SAPSQLLNYIDGNFVTS--ASSFANINPVNGKLISDVFEADAKQVNEAVVAAQNALGPWGKLSVQDRAALIHKIADGIQARFEEFVAAEVADTGRPVHQARTLDIPRAIANFRTFADLAKTSHTDLFEMSSGALNYTVRKPLGVIGVISPWDLPLLLFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMHDAGVPPGVFNLIHGFGKDAGEFLTQHPGISALTFTGESKTGSTIMKAVA-DGVKEVSFELGGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVSGLKVEAERLVVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGGGVPKNDERDQGAYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWTTNLSRAHRVSRQIHVGLVWVNTWYLRDLRTPFGGVKLSGLGREGGRFSMDFYSDIANICIKI....... 514
23 -126.0004o5h_A mol:protein length:511 Phenylacetaldehyde dehydrogenase  ali model follow..  40  23....KPKQMLIGAEWSDAASGRQLDVVNPADGTVIARVPEADERDVQQAVAAARRAFGPWRTAKTTDRERLMLVLADLIEANARELAEIESLDNGKPVMVAQGLDVAMAAQCFRYMAGWATKIEGSVIDAGSEIFAYTRKEPVGVVGAIIPWNFPLLMAAWKIAPALATGCTVVLKPAEDTPLSALRLGELIQAAGFPDGVVNIVTGYGHTAGAALSRDPRIDKIAFTGSTQTGKTIGHAAL-DNMTRMSLELGGKSPVIVLPDVDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERVAKIAASLKIGPGMDPATQIGPLVSAKQRERVCGYIDSGFGEGARAAAGGRAID----GPGFFVEPTVLVDTTQAMRVVREEIFGPVLVAMPFDDVDTAVQLANDTPYGLGASIWSNDLSAIHKLVPRIAAGTVWVNCHSLLDNALPFGGMKQSGFGRELGRAVIDQYTESKSVMMNYA...... 505
24 -126.0004i9b_A mol:protein length:517 Putative betaine aldehyde dehyrogenase  ali model follow..  40  13.VPIPRRQLYIGGEWREPVKKNRIPIINPATEEIIGDIPAATAEDVDIAVEAARKAIDDWGSTTGAQRAKYLRAIAAKVLEKKSVLATLESLDSGKTLYESAA-DMDDVAGCFEYYAGLAEALDSRRMTPSDSYKSYVLREPLGVVGLITPWNYPLLMAIWKVAPALAAGCAAILKPSELASITCLELGEICREIGLPSGALNILTGLGPEAGGPLASHPHVDKISFTGSGPTGSKIMTAAA-QLVKPVSLELGGKSPIVVFDDIDLDIAAEWTLFGIFANTGQVCSATSRLIVQENIASAFMDRLLKWTKNIKISDPLEEDCKLGPVVSAGQYEKVLKFISNAKSEGATILCGGERPQ--HLKKGYYVQPTIITDVNTSMEIWKEEVFGPVLCVKTFKTEEQAIELANDTKYGLGAAVMSKDVKRCERFTKAFQTGIIWINCSQPTFNELPWGGKKRSGFGRDLGKWGLENFLNIKQVTEYTSAEP... 501
25 -126.0003iwj_A mol:protein length:503 Putative aminoaldehyde dehydrogenase  ali model follow..  39  3.IPIPTRQLFINGDWKAPVLNKRIPVINPATQNIIGDIPAATKEDVDVAVAAAKTALADWATASGAVRARYLRAIAAKVTEKKPELAKLESIDCGKPLDEAAW-DIDDVAGCFEYYADLAEKLDARQKAPMDTFKSHVLREPIGVVGLITPWNYPMLMATWKVAPALAAGCAAILKPSELASLTCLELGEICKEVGLPPGVLNILTGLGPEAGAPLATHPDVDKVAFTGSSATGSKIMTAAA-QLVKPVSLELGGKSPLVVFEDVDLDKAAEWAIFGCFWTNGQICSATSRLILHESIATEFLNRIVKWIKNIKISDPLEEGCRLGPVVSEGQYEKILKFVSNAKSEGATILTGGSRPE--HLKKGFFIEPTIITDVTTNMQIWREEVFGPVLCVKTFSTEEEAIDLANDTVYGLGAAVISNDLERCERVTKAFKAGIVWVNCSQPCFTQAPWGGVKRSGFGRELGEWGLDNYLSVKQVTQYISEEP... 493
26 -126.0003iwk_A mol:protein length:503 Aminoaldehyde dehydrogenase  ali model follow..  40  4..TVSSRQLFIDGEWRVPILNKRIPNINPSTENIIGDIPAATKEDVDLAVDAAKRAIRDWSAASGSLRARYLRAIAAKIKEKKDELGKLESIDCGKPLEEALA-DLDDVVACFEYYAGLAEELDSKQKAPMDTFKSYILKEPIGVVALITPWNYPFLMATWKIAPALAAGCAAILKPSELASVTCLELGEICKEVGLPRGVLNIVTGLGHEAGASLASHPDVDKISFTGSSATGSKIMTTAA-QLVKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHESIAVEFVDKLVKWAENIKISDPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGATILTGGRRPE--HLKKGYFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGLGSAVMSNDLERCERLSKALQAGIVWINCAQPSFIQAPWGGIKRSGFGRELGEWGLENYLSVKQVTRYTSDEP... 493
27 -126.0001a4s_A mol:protein length:503 BETAINE ALDEHYDE DEHYDROGENASE  ali model follow..  49  15.VVVTDDLNYWGGRRIKSKDGATTPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEVINNGKTITEAEY-DIDAAWQCIEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQG-GAETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSA-KTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPLTDPKLKNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVAANLEAGTCYINTYSISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVEMGDVDSLF 503
28 -126.0004v37_A mol:protein length:497 BETAINE ALDEHYDE DEHYDROGENASE, CHLOROPLASTIC  ali model follow..  38  4..PIPARQLFIDGEWREPIKKNRIPVINPSTEEIIGDIPAATAEDVEVAVVAARRAFNNWSATSGAHRATYLRAIAAKITEKKDHFVKLETIDSGKPFDEAVL-DIDDVASCFEYFAGQAEALDGKQKAPMERFKSHVLRQPLGVVGLISPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTGLGPDAGAPLVSHPDVDKIAFTGSSATGSKVMASAA-QLVKPVTLELGGKSPIVVFEDVDIDKVVEWTIFGCFWTNGQIASATSRLLVHESIAAEFVDKLVKWTKNIKISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILYGGSRPE--HLKKGYYIEPTIVTDISTSMQIWKEEVFGPVLCVKTFSSEDEAIALANDTEYGLAAAVFSNDLERCERITKALEVGAVWVNCSQPCFVQAPWGGIKRSGFGRELGEWGIQNYLNIKQVTQDISDEP... 490
29 -126.0002o2p_A mol:protein length:517 Formyltetrahydrofolate dehydrogenase  ali model follow..  40  30....MPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFGLWGKINARDRGRLLYRLADVMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMKIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVP----RPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTFEY....... 512
30 -125.0004qyj_A mol:protein length:516 Aldehyde dehydrogenase  ali model follow..  40  27....LPHQMLIGGQWVSAQSGKTLNVYNPATGDILTEVPDGDVEDVNAAVESAAATLDTWRRMPPSARERILLRLADLLEVHGDELARLETLNNGKLLIYSKLMEVGASAQWLRYMAGWATKLTGSTLDLSVRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAEETPLTALRLAELAMEAGLPAGALNVVTGRGETAGDALVRHPKVAKVAFTGSTEVGRIIGSACG-RSLKAVSLELGGKSPVIVLADCDPQEAAEGAAAAIFFNHGQVCTAGSRLYVHESIYEDVIQRLAVIGESIVVGSGLEQGVHMGPMVSKKHHENVLRHIRNGIEDGADLICGGTEAPC---AQGFFVKPTIFANRKKDIRLLSQEVFGPVLVATPFSDIAEVVNEANRSVYGLGASIWTNDLSAALRINDELEAGTVWVNTHNMVDPNLPFGGFKDSGVGREHGAAAIEHYTTTRSLVIAY....... 510
31 -125.0003r31_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  54  9LKAQPKASHFIDGDYVEDNTGTPFESIFPATGEMIAKLHAATPAIVERAIASAKRAQKEWAAMSPMARGRILKRAADIMRERNDALSTLETLDTGKPIQETIVADPTSGADAFEFFGGIAPSALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWKAAPALVAGNAMVFKPSENTPLGALKIAEILIEAGLPKGLFNVIQGDR-DTGPLLVNHPDVAKVSLTGSVPTGRKVAAAAA-GHLKHVTMELGGKSPMIVFDDADIESAVGGAMLGNFYSSGQVCSNGTRVFVQKKAKARFLENLKRRTEAMILGDPLDYATHLGPLVSKAQQEKVLSYIEKGKAEGATLITGGGIPNNVA-GEGAYVQPTVFADVTDDMTIAREEIFGPVMCVLDFDDEDEVLARANATEFGLAGGVFTADLARAHRVVDGLEAGTLWINTYNLCPVEIPFGGSKQSGFGRENSAAALEHYSELKTVYVSTGKVDAPY 495
32 -125.0004u3w_A mol:protein length:505 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  40  13.RDRQLLRHYINGEFVAS--GTTFPNLSPVDGRKLADVCEADAALVDSAVQAAHAAQKAWRDTTPAQRAAWLHKIADGIEARFDEFVAAEVADTGRPVAQARTLDIARGIANFRTFADLVRTASGEYFETHSELINYVTRKPLGVIGIISPWNLPLLLFTWKVAPALAMGNCVVAKPSEETPSSATLLAEVMHDVGLPPGVFNLIHGHGQNAGEFLTRHPDISAITFTGESRTGSTIMKAVA-DGVKEVSFELGGKNAAVVFADADFDAAVAGVLRSSFTNAGQVCLCSERVYVERPIFERFVAALKEQAQALRVGAPEDPATTMGPLISRGHRDKVLSYFRLAVEEGATVVTGGGAPSFGDRDDGAFVMPTIWTGLPDSARCVREEIFGPVCHIAPFDDEAEVVKRVNDSAYGLAASIWTTQLARGHRVAKQIETGIVWVNAWFVRDLRTPFGGTKLSGLGREGGRHSLDFYSELTNVCVRIA...... 499
33 -125.0004dal_A mol:protein length:498 Putative aldehyde dehydrogenase  ali model follow..  35  15.QSMMDTQLLIGSRFEAG-TEAEEHILNPRTGAGIIDLAEASHAQIDAAVDAAERAFVGWSQTTPAERSNALLKIADAIEKEADEFAALEALNCGKPINAVKNDELPAIIDCWRFFAGAVRNLHAPAAGEYPGHTSMIRRDPIGIVGSIAPWNYPLMMMAWKLAPAIGGGNTVVFKPSEQTPLTALKLARLIADI-LPEGVVNVITGRGETVGNALINHPKVGMVSITGDIATGKKVLAAAA-KTVKRTHLELGGKAPVIVYGDADLEAVVNGIRTFGYYNAGQDCTAACRIYAEAGIYEKLVADLTSAVSTIRYNLDDDTENEIGPLISRRQRDRVASFVERAADQKHIEITTGGRTGS---DEGFFFQPTVVAGATQEDEIVRREVFGPVVSVTRFTGKDDAVAWANDSDYGLASSVWTKDISKAMRAASRLQYGCTWINTHFMLTNEMPHGGIKQSGYGKDMSVYALEDYTAVRHIMINHG...... 492
34 -125.0004lih_A mol:protein length:504 Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase  ali model follow..  43  21.....EGRAFIDGASRDAHGGRTFDCVSPIDGRVLAKVADCGEADVNAAVAAARRAFGVWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPIGDTTTVDVPGAAYCVEWFAEAIDKVGGEVAPADHHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEAGIPAGVFNVVPGAG-EPGKLLALHRDVDCIAFTGSTAVGKLIMQYAAQSNLKRAWLELGGKSPNIVLPDCDLDRAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVSMGAIVDGIQLERVLGYIEAGRGEGRLVTGGARV---NAETGGFYVEPTVF-EVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTEYGLAAAVWTSNLTTAHDVSRRLRAGTVWVNCYDEGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLIRLR...... 498
35 -124.0003k2w_A mol:protein length:497 Betaine-aldehyde dehydrogenase  ali model follow..  35  8.LHFKNKVNFIGGQYVPSNESDTIDILSPSTGKVIGEIPAGCKADAENALEVAQAAQKAWAKLTARTRQNMLRTFANKIRENKHILAPMLVAEQGKLLSVAEM-EVDVTATFIDYGCDNALTIEGDILPSDQDEKIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNTMVLKPTQETPLATTELGRIAKEAGLPDGVLNVINGTGSVVGQTLCESPITKMITMTGSTVAGKQIYKTSA-EYMTPVMLELGGKAPMVVMDDADLDKAAEDALWGRFANCGQVCTCVERLYVHASVYDEFMAKFLPLVKGLKVGDPMDADSQMGPKCNQREIDNIDHIVHEAIKQGATVATGGKTATVEGFEGGCWYEPTVLVDVKQDNIVVHEETFGPILPIVKVSSMEQAIEFCNDSIYGLSAYVHTQSFANINQAISDLEVGEVYINRGMGEQHQGFHNGWKQSGFGGEDGKFGLEQYLEKKTVYINEAE..... 490
36 -124.0001wnb_A mol:protein length:495 Putative betaine aldehyde dehydrogenase  ali model follow..  39  13.AGLMQHKLLINGELVSG-EGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGLAAGEYEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDI-FPAGVVNILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTA-SSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRK---GNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVK........ 488
37 -124.0003i44_A mol:protein length:497 Aldehyde dehydrogenase  ali model follow..  32  15.SMLNKRKFYINGLWDDPSTPHDLYVIDPSTEEACAVISLGSTRDADKAINAAKKAFQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPIDMALNAQTATGSSHIRNFIKAYKEFSFQEALIEGNEQAILHYDAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSAMLFAEILDEAALPSGVFNLINGDGANVGSYLSAHPDLEMISFTGSTRAGKDISKNAS-NTLKRVCLELGGKGANIIFADADID-ALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNHIGPVVSKEQYDKIQDLIQSGIDEGATLVTGGTGLP-MGMERGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRIAAQVRSGMVEVNGHE-LPGGSYFGGVKFSGRAREGGLWGIKEFLDTKAIS.......... 489
38 -124.0003rh9_A mol:protein length:506 Succinate-semialdehyde dehydrogenase (NAD(P)(+))  ali model follow..  32  7.PLLENLTGYIGGRWKDSAGGATFDVYNPATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKPWKEAQG-EVDYAAGFFDYCAKHISALDSHTIPEKKDCTWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKLDLPDGMVNLVMGKASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTA-EQVKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIDIGPLINKQGFDKVKRHLQDALDKGASLVAGKQPAE---LGDGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGLASYVFTADAERAQRVAAGLRFGHVGWNTGTGPTPEAPFGGMKASGIGREGGLEGLFEFVEAQTVPRGFAENL... 488
39 -123.0005izd_A mol:protein length:508 D-glyceraldehyde dehydrogenase (NADP(+))  ali model follow..  30  2.....DTKLYIDGQWVNSSSGKTVDKYSPVTGQVIGRFEAATRDDVDRAIDAAEDAFWAWNDLGSVERSKIIYRAKELIEKNRAELENIIMEENGKPVKEAKE-EVDGVIDQIQYYAEWARKLNGEVVEGTSHRKIFQYKVPYGIVVALTPWNFPAGMVARKLAPALLTGNTVVLKPSSDTPGSAEWIVRKFVEAGVPKGVLNFITGRGSEIGDYIVEHKKVNLITMTGSTATGQRIMQKAS-ANMAKLILELGGKAPFMVWKDADMDNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFMSRFVELSRKLALGDPKN--ADMGPLINKGALQATSEIVEEAKESGAKILFGGSQPSSGPYRNGYFFLPTIIGNADQKSKIFQEEIFAPVIGARKISSVEEMYDLANDSKYGLASYLFTKDPNIIFEASERIRFGELYVNMPGPEASQGYHTGFRMTGQAGEGSKYGISEYLKLKNIYVDYSGKP... 481
40 -123.0005x5t_A mol:protein length:505 Alpha-ketoglutaric semialdehyde dehydrogenase  ali model follow..  35  22.VTYTDTQLLIDGEWVDAASGKTIDVVNPATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAATMRKAAALVRERADAIAQLMTQEQGKPLTEARV-EVLSAADIIEWFADEGRRVYGRIVPPRLGAQQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLRAFVDAGVPAGVIGLVYGDPAEISSYLIPHPVIRKVTFTGSTPVGKQLASLAG-LHMKRATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVKHAEGLKVGNGLEEGTTLGALANPRRLTAMASVIDNARKVGASIETGGERIG----SEGNFFAPTVIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGLAGYAFTRSFANVHLLTQRLEVGMLWINQPATPWPEMPFGGVKDSGYGSEGGPEALEPYLVTKSVTVM........ 497
41 -123.0003ek1_A mol:protein length:504 Aldehyde dehydrogenase  ali model follow..  34  22.PSLLKSQCLVNGRWIDAADGTTIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMTSEQGKPLAEARG-EVLYAASFIEWFAEEAKRVYGDTIPAPNGQRLTVIRQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSTEVGRLLMAQCA-PTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKEL------GGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYICSAYKR..... 498
42 -123.0004ywe_A mol:protein length:487 Putative aldehyde dehydrogenase  ali model follow..  38  2..AMEEAKHFIAGEWTLPAQLETIPVVDPSDGQPFATIARGTAPDIERAVAAARDAFGPWGAASAAERGRVLMRLSARVTDSIEELAAIEARDTGKPLKQARA-DAAALARYFEFYAGAADKLHGETLPYQAGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACLSVLRVAELAAEAGLPAGALNIVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAA-ENHVPVTLELGGKSPQIVFADADLDAALPVLVSAIVQNGGQTCSAGSRVLIERAVYEPLVERLATAFNGLRVG-PSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAAHGQVVADA-PESGFYQAPALLRDVPPSHRLAQEEVFGPVLAAMRFVDEDEAVALANGTPYGLVAGIWTRDGARQMRLARRLRAGQVFINNYGAGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIRHG...... 481
43 -123.0003b4w_A mol:protein length:495 Aldehyde dehydrogenase  ali model follow..  38  4.SATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTIIETMHWMGSMGAMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPG-GIETGQALTSNPDIDMFTFTGSSAVGREVGRRAA-EMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRPE--GLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYA-FDPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLLPMGYTV... 486
44 -122.0006c43_A mol:protein length:477 Gamma-aminobutyraldehyde dehydrogenase  ali model follow..  40  1.SNAMQYQLLINGVLVDG-EGERQSVYNPATGEVILEIAEASPAQVDAAVQAADNAFAEWGQTTPKARAECLLKLADSIEQNALEFARLESQNCGKPLHCVINDEIPAIVDVFRFFAGAARCLSGLAAGEYEGHTSMIRRDPIGVVASIAPWNYPLMMAAWKLAPALAAGNCVVIKPSEITPLTALKLAVLA-KDIFPPGVLNVLFGRGQTVGDVLTGHEKVRMVSLTGSIATGEHILRHTA-PAIKRTHMELGGKAPVIVFDDADLDAVAQGVRTFGFYNAGQDCTAACRIYAQRGIYDALVEKLGNAVSSLKMGAPEDESTELGPLSSLAHLKRVTAAVEEAKLSHIRVITGGSQTE----GKGYYFAPTLLADAKQEDAIVQREVFGPVVSITVFDDEDQVLRWANDSRYGLASSVWTQDVGRAHRLSARLQYGCTWINTHFMLVSEMPHGGQKQSGYGKDMSLYGLEDYTLVRHIMVK........ 476
45 -121.0002hg2_A mol:protein length:479 Aldehyde dehydrogenase A  ali model follow..  34  1MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEV-EVAFTADYIDYMAEWARRYEGEIIQSDPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAA-KNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVE----GKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQ........ 478
46 -121.0005vbf_A mol:protein length:478 NAD-dependent succinate-semialdehyde dehydrogenase  ali model follow..  35  2.HDYAPLRLYIDGRFHDADGRRTQPVVDPGTTRVLGELPHATAHDIDAAVQAAHRAFVTWRHESPLVRSDLLRRAAALARERAETIGRHITMDQGKPLREAIA-EVVSAAEQLEWHAEEGRRTYGRVVPARPDVMQTVLREPIGVCAAFSPWNFPFSQAMHKIAAALASGCTLVLKGPEESPSAIVALAQLFHDAGLPPGCLNIVWGVPGDVSKQLIEAPQVRKISFTGSVPVGKQLAALAA-SLMKRMTMELGGHAPVLVCADADVERAAAMLAAYKFRNAGQVCVSPTRFFVQRAAFDRFVCAYLDAVGTIRVGYGLDAGVTMGPLAHARRVDEIDAFVADATAKGAQIATGGMRLP----GPGHYFAPTVVLGPTRDTRLMNDEPFGPIVGIVPFDDLDDALAEANRLPFGLASYAFTTSARNAHRISRALEAGMVNINHFGMGPAEIPFGGVKDSGFGSEGGMEAFDGYLVTKFVTQM........ 477
47 -121.0003r64_A mol:protein length:508 NAD dependent benzaldehyde dehydrogenase  ali model follow..  33  8.AGIDATKHLIGGQWVEGNSDRISTNINPYDDSVIAESKQASIADVDAAYEAAKKAQAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGSTRSKANL-EITLAGNITKESASFPGRVHGRISPSNPGKENRVYRVAKGVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTGGVIARIFEEAGVPAGVISTVAGAGSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAINGPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDPSAEGTLVGPVINDSQLSGLKEKIELAKKEGATVQVEGPI-------EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQFALQIDSGMVHINDLTVNDPHVMFGGSKNSGLGRFNGDWAIEEFTTDRWIGIKRSAENLYF 492
48 -121.0004v6h_A mol:protein length:484 Succinate-semialdehyde dehydrogenase (NADP+)  ali model follow..  36  8.PSLLRHQAYIGGEWQAADSDATFEVFDPATGESLGTVPKMGAAETARAIEAAQAAWAGWRMKTAKERAAILRRWFDLVIANSDDLALILTTEQGKPLAEAKG-EIAYAASFIEWFAEEGKRVAGDTLPTPANKRIVVVKEPIGVCAAITPWNFPAAMIARKVGPALAAGCPIVVKPAESTPFSALAMAFLAERAGVPKGVLSVVIGDPKAIGTEITSNPIVRKLSFTGSTAVGRLLMAQSA-PTVKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFADKLAAAVSKLKVGRGTESGATLGPLINEAAVKKVESHIADALAKGASLMTGGKRHA----LGHGFFEPTVLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRVAEALEYGMVGINTGLISNEVAPFGGVKQSGLGREGSHYGIDDYVVIKYLCVAV....... 484
49 -121.0003jz4_A mol:protein length:481 Succinate-semialdehyde dehydrogenase [NADP+]  ali model follow..  37  5.SNLFRQQALINGEWLDANNGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKG-EISYAASFIEWFAEEGKRIYGDTIPGHADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCA-KDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAMSKLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAHE----RGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYARDLSRVFRVGEALEYGIVGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCIGL....... 481
50 -121.0003ty7_A mol:protein length:478 Putative aldehyde dehydrogenase SAV2122  ali model follow..  37  6....DYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMG---LNHFVAARDALDNYEFEE-RRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAA-KDFKKVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELKEQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKP-EGLEKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLHKVARSIEAGTVEINEAG-RKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK...... 478
51 -120.0004h73_A mol:protein length:491 Aldehyde dehydrogenase  ali model follow..  33  4.LNIMKVANYINGEFKEPSTGAFQVKTSPVDGSKIAEVPRSGREDAREAIDSAFEALKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGGTYRKVWG-EVVFTERLIQNAAELARHYQGRVLQSDESTISVVFKRSKGVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTGWLIAQMVAKAGLPKGVFNLVIGPGPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA-GTLKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDPRDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLIGGRS-------WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFPI 486
52 -119.0004dng_A mol:protein length:485 Uncharacterized aldehyde dehydrogenase AldY  ali model follow..  29  1MSFETLNKSFINGKWTGGESGRTEDILNPYDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGGTIIKSTI-ELEQTIAILDEAMTYTGELGGVKESDIEGKTNKIYRLPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGTIIAKAFEHAGLPAGVLNVMLTDVKEIGDGMLTNPIPRLISFTGSTAVGRHIGEIAG-RAFKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQGQICMIINRIIVHQDVYDEFVEKFTARVKQLPYGDQTDPKTVVGPLINERQIEKALEIIEQAKTDGIELAVEGKR-------VGNVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGLSSAVFTSDLEKGEKFALQIDSGMTHVNDQSVNDPNIAFGGNKASGVGRFGNPWVVEEFTVTKWISIQKQYRKYPF 485
53 -119.0004e4g_A mol:protein length:521 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  31  16.SMMYELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVALASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKTIDDAKG-DIVRGLEVCEFVIGIPHLQKSEFTEGGPGIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGILNVVNGDK-GAVDAILTHPDIAAVSFVGSTPIARYVYGTAA-MNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISAVPVGEETANRLIDKLVPMVESLRIGPYTDEKADMGPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKLQGYENGHFIGGCLFDDVTPDMDIYKTEIFGPVLSVVRARNYEEALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPAYHSFGGWKSSSFGNQHGTDSIKFWTRTKTITSRWPSGI... 503
54 -118.0003prl_A mol:protein length:505 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  33  7.TEQFNANILRNGEWVESRTGERISISAPASGVALGSIPALSQEEVNDAIQGAKDAQKIWKIRPIHERVDLLYAWADLLEERKEIIGELIMHEVAKPKKSAIG-EVSRTADIIRHTADEALRLNGETLKGDSKKIALVEREPLGVVLAISPFNYPVNLAAAKIAPALVTGNTVVFKPATQGSLSGIKMVEALADAGAPEGIIQVVTGRGSVIGDHLVEHPGIDMITFTGGTTTGERISEKA---KMIPVVLELGGKDPAIVLDDADLKLTASQIVSGAFSYSGQRCTAIKRVFVQDSVADQLVANIKELVEQLTVGSPEDD-ADITPVIDEKSAAFIQGLIDDALENGATLLSGNKR-------QGNLLSPTLLDDVTPAMRVAWEEPFGPVLPIIRVKDANEAISLSNQSDYGLQASIFTKDTDRAINIGKHLEVGTVHINAKTERGPHFPFLGVKKSGLGVQGIKPSLLSMTRERVTVLNLAENL... 487
55 -118.0005tjr_A mol:protein length:531 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  28  26.GSMTLIKHLIGGELIAD-TGRTADVFNPSTGEAVRKVPLADRETMQQAIDAAKAAFPAWRNTPPAKRAQVLFRFKQLLEANEERIVKLISEEHGKTIEDAAG-ELKRGIENVEYATAAPEILKGEYSRVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAIACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDK-GAVDALIEAPEVKALSFVGSTPIAEYIYSEGT-KRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCMAISAVCVGDQIADALVQKLVPQIKGLKIGAGTSCGLDMGPLVTGAARDKVTGYIDTGVAQGAELVVDGRGYKVAGHENGFFLGGTLFDRVTPEMTIYKEEIFGPVLCIVRVNSLEEAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPAYHSFGGWKRSLFGHAYGPDGVRFYTKRKAITQRWPQRK... 512
56 -117.0002w8n_A mol:protein length:487 SUCCINATE-SEMIALDEHYDE DEHYDROGENASE, MITOCHONDRIAL  ali model follow..  34  8.AALLRTDSFVGGRWLPA--AATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHG-EILYSAFFLEWFSEEARRVYGDIIHTPKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAA-NSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQ----LGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYG........ 485
57 -117.0006fk3_A mol:protein length:536 Aldehyde dehydrogenase  ali model follow..  32  9.GNTLEFGHLVGGEEVL--EGPLLERRNPSDREVVARFPEADKDLVRKAALKAREAFAEWSRTPAPIRGQVLFNLVKILEREKPTLTRLMVREVGKTPKEAAG-DVQEAIDTALFFASEGRRLYGQTVPSERDKELFTFRRPLGVVGIITAGNFPIAVPSWKLIPAVLTGNTVVWKPSEDAPTLSFVFAKLFEEAGLPPGVLNVVFGGGKQWMVELMDEGLFQKFAFTGSTQVGRWIGEVAG-RNLIRPTLELGGKNPLVVMRDADLDLAVEGAWWSAFATGGQRCTSAGNILVDAPIYEEFKRRFLERVEATLVGNPLHPEVTYGPFINERFFARWQEHYRVGEAEGARLLFGRGRITRGDPEAGLYGWPTVW-EVRPGTRLFTEEVFGPTINLVKVDGIEEAIAVANSTPYGLSSAIYTNHRHWAYLFKVGIRAGMTSINNATVAEAHLPFGGVKASGNGRESGIWVLEEYTYWHAVNEEYSGR.... 505
58 -116.0004jz6_A mol:protein length:500 Salicylaldehyde dehydrogenase NahF  ali model follow..  31  9.QGHMKTKLFINNAWIDSSDQQTFERKHPVSSEVMTESANATVTDAIKAAQAAEEAFKTWKDVGPSERRRLLLKVADVMESKTPKFIEVMAMEVGASALWAGF-NVHASANVFREAASLATQIQGETIPTDAETLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPATHALITQCVQEAGLPAGVLNYLNSSSPEIADALISAKEIRRINFTGSTRVGSIIAQKAA-QHLKRCLLELGGKSPLIVLDDADINAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEFVARFVEKTERLSVGDPLTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGMA-------QGAVMPATILDHVKSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSVYGLSSGVFGRDINRALRVGMSIEYGCVHINGSTVQNAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQYPF 494
59 -116.0001t90_A mol:protein length:486 Probable methylmalonate-semialdehyde dehydrogenase  ali model follow..  33  1.AEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALG-EVGRGIENVEFAAGAPSLMMGDSLAIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYGAH-DVVNGILEHPEIKAISFVGSKPVGEYVYKKGS-ENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVS---DDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFRENIDAGMLGINLGVPAPAFFPFSGWKSSFFGHANGKDSVDFYTRKKVVTARYPAPD... 484
60 -116.0004zz7_A mol:protein length:501 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  28  2.SHMTTIGHLINGQLVTE-NTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQHADEICRLIGEEHGKIAHDAMG-ELQRGIENVEYACGAPELLKGEHSRVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLWMFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEAGLPDGVMNVVNGDK-EAVDALLHDDRVKAVSFVGSTPIAEYIYRTAS-ANGKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSGNDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVPNHENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAMDLIDAHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINIPLPVPAYHSFGGWKRSLFGHAYGPDAVRFYTKRKTVTQRWPSAG... 488
61 -115.0003ros_A mol:protein length:484 NAD-dependent aldehyde dehydrogenase  ali model follow..  27  2...................VMSKYQSVNPYTNEAFASYDNPTSKQIDEAINLAHALYKKWRHEEPASRAEILHDIANALKEHEDELAKMMTLEMGKLLSESKE-EVELCVSICNYYADHGPEMLKPTKLNSDLGNAYYLKQSTGVIMACEPWNFPLYQVIRVFAPNFIVGNPILLKHAHNVPGSAALTAKIIKRAGAPEGSLINLYPSY-DQLADIIADPRIQGVALTGSERGGSAVAEAAG-KNLKKSTMELGGNDAFIVLDDADPQVLRNVLNDARTYNDGQVCTSSKRIIVEKSRYDEVLHELKNVFSNLKAGDPLEADTTLPPMNSEKAKEKLEAQVKEAIDAGAKVFYQYPEID----SKGAFFRPTILTDIAKDNPVFDKEVFGPIAEVFVVEDDNAAIQLANDSSYGLGSSVIGSDIDRAKKVSAQIETGMTVINGRWITSGELPFGGIKKSGYGRELSGLGLMAFVNEHLVIDVTKNNQ... 462
62 -115.0003vz2_A mol:protein length:470 Succinate-semialdehyde dehydrogenase  ali model follow..  28  1...........SSGLVPRGSHMAIATINPTTGEICQRFKALTPAEIDAKLAKAQEAFQAYRRTSFSQRRQWLENAAAILERDTSKFAEIMTTEMGKTHQSAIA-EAEKSALVCRYYAEHGEQFLANEYTETQATESYVCYQPLGILLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAAGFPEGVFQTLLI-GASQVEQVIKDPRVKAATLTGSEPAGASLASLAG-QEIKPTLLELGGSDPFVVFPSADLDEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKIGDPMAPETDIGPLATEGILQDISRQVDQAVAAGAKILLGGRPLD----RAGYFYPPTILTEIPPGAKILQEELFAPVAMVFTVKDLDQAIALANDIPFGLGASAWTNDPAEQQRFIQELDAGAVFINGMVKADPRLPFGGTKRSGYGRELGLAGIRTFVNAKTVWLK........ 464
63 -115.0004x0t_A mol:protein length:513 Alpha-aminoadipic semialdehyde dehydrogenase  ali model follow..  29  23....EENEGVYNGSWGG--RGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVG-EVQEYVDICDYAVGLSRMIGGPILPSESGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIEDNKLPGAICSLTCG-GADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQ-ERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMD----RPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWPKGSDCGIVNVNIPTSAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKD.... 503
64 -115.0002jg7_A mol:protein length:510 ANTIQUITIN  ali model follow..  30  20....EDNPGVYNGSWGG--SGEVITSYCPANNEPIARVTQATLAEYEETVQKTREAWKMWADIPAPKRGEIVRQIGDALRKKIKVLGSLVSLEMGKIYVEGVG-EVQEYVDVCDYAVGLSRMIGGPVLPSEPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVAVTKIVAENNLPGAICSMTCG-GADIGTAMAKDERVDLLSFTGSTHVGKMVAMMVQ-ERFGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVVERIAKAYKQVRIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGKVMD----RPGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDLGRVFRWPKGSDCGIVNVNIPTSAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKD.... 500
65 -115.0003ju8_A mol:protein length:490 Succinylglutamic semialdehyde dehydrogenase  ali model follow..  28  1.SNAMMSTHYIAGQWLAG-QGETLESLDPVGQGVVWSGRGADATQVDAAVCAAREAFPAWARRPLEQRIELLERFAATLKSRADELARVIGEETGKPLWESAT-EVTSMVNKVAISVQAFRERTGEKSGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAELTLKAWIQAGLPAGVLNLVQG-GRETGVALAAHRGLDGLFFTGSSRTGNLLHSQFGGQPQKILALEMGGNNPLVVEEVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWDALLARLVAVSATLRVGRFDQPAPFMGAVISLSAAEHLLKAQEHLIGKGAQPLLAMTQPI----DGAALLTPGIL-DVSAVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGLAAGLLSDSRERFEQFLVESRAGIVNWNKLTGAASSAPFGGIGASGNHRPSAYYAADYCAYPVASLESPSVS.... 480
66 -115.0004pxn_A mol:protein length:525 Uncharacterized protein  ali model follow..  28  28..AQRNPGAFACGAWGG--SGPTVTSTSPTNNQVIAEVVEASVHDYEEGMRACFDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIG-EVQEIIDMCDYAVGLSRQLNGSIIPSEPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVEKNNLPGAIFTSFCG-GTEIGQAIALDIRIPLVSFTGSTRAGLMVQQQVS-ARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLILHENIYQTFLDQLVEVYKQVRIGDPLEKGTLLGPLHTPASKENFLKGIQTIKSQGGKILFGGSAIE----SEGNFVQPTIV-EITPSAPVVKEELFGPVLYVMKFQTLKEAIEINNSVPQGLSSSIFTKRPDIIFKGPHGSDCGIVNVNITNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRATCTINYGSE.... 509
67 -115.0004kna_A mol:protein length:495 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  28  1...MAMTELFIDGAWVDG-AGPVFASRNPGTNERVWEGASASADDVERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKPLWEART-EVASMAAKVDISITAYHERTGEKRAPMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVVFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEK-DTGVALANHRQIDGLFFTGSSDTGTLLHKQFGGRPEIVLALEMGGNNPLVVAEVEDIDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFDRFVARLADVASKITASFDADPQPFMGAVISARAASRLVAAQARLVGLGASPIIEMKQRD----PALGFVNAAIL-DVTNVRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGLSAGLLADDEQAWHTFRRAIRAGIVNWNRTNGASSAAPFGGAGRSGNHRPSAYYAADYCAYPMASVESAQLQ.... 478
68 -114.0005u0l_A mol:protein length:497 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  28  2..ANLTGNVYIDGLWLPG-HGAPFESVQPVTGETVWDGNAASLEDVDAAVREARKAFLAWRRKSLAERQAVIEAFGELLEANKEELAHQIGLETGKPLWESRT-EVAAMMGKIPISVKAYNERTGHTESDVAGGHAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVRLWEKAGLPDGVINLVQG-GSDTGKCLARHSLIDGLFFTGSSTVGHLLHEQFGGQPEKILALEMGGNNPLIVQNVSDLDGAVHHALQSAFLSAGQRCTCARRLLVPKGKKDEFLARLVEVAARITVAEDADPQPFMGSVISAEAANQLLKAQAAMLEKGATSLLEMKQLK----PDTGLLSPGIVDAT--GIELEDQEFFGPLLTVYRYKGFDEALELANNTRYGLSAGILSDDRKLYNRLVEEVRAGIVNWNRLTGASSAAPFGGVGASGNHRPSAYYAAD-YCAWPMASLEAGKSELPD 482
69 -114.0005mz5_A mol:protein length:515 ALDH21)  ali model follow..  29  29.VTPKKYNIFLASKPVDG-DRKWLDVTNKYTNDVAAKVPQATHKDIDDAIDAAVAAAPAMAAMGAYERKAVLEKVVAELKNRFEEIAQTLTMESGKPIKDARG-EVTRTIDTFQVAAEESVRIYGEHIPLDKGLQGIVKKFPIGPVSMVSPWNFPLNLVAHKVAPAIAVGCPFVLKPASRTPLSALILGEILHKEELPLGAFSILPVSR-EDADMFTVDERFKLLTFTGSGPIGWDMKARAG---KKKVVMELGGNAPCIVDDYVDLDYTIQRLINGGFYQGGQSCIHMQRLYVHERLYDEVKEGFVAAVKKLKMGNPFEEDTYLGPMISESAAKGIEDWVKEAVAKGGKLLTGGNR-------KGAFIEPTVIEDVPIEANARKEEIFGPVVLLYKYSDFKEAVKECNNTHYGLQSGIFTKDLNKAFYAFEHMEVGGVILNDSPALRDSQPYGGLKDSGIQREGVKYAMDDMLETKVLVMRNVGT.... 508
70 -114.0001ky8_A mol:protein length:501 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  31  14.GGVPVYPSYLAGEWGG--SGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRSARDMPGTERLAVLRKAADIIERNLDVFAEVLVMNAGKPKSAAVG-EVKAAVDRLRLAELDLKKIGGDYIPGDLETEGLVRREPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPG-KEAEKIVADDRVAAVSFTGSTEVGERVVKVGG---VKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDPTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAGGRRL------GPTYVQPTLVADRVKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINDMPRHGIYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFNYKGKG... 496
71 -114.0003rjl_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  30  36....QSYPLVIDGERYE--TENKIVSINPANKEVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFRAVAKVRRKKHEFSALLVKEAGKPWNEADA-DTAEAIDFMEYYARQMIELAKGKPVNSEGERNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVLEESGLPKGVVNFVPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKTHLKQVIAEMGGKDTVVVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKRVIEITESKKVGEPDSADVYMGPVIDQASFNKIMDYIEIGKEEGR-LVSGGKGDD----SKGYFIEPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITKNRDHINRAKQEFHVGNLYFNRTGAIVGYHPFGGFKMSGTDSKAGPDYLALHMQAKTISEMFAEN.... 519
72 -114.0001euh_A mol:protein length:475 NADP DEPENDENT NON PHOSPHORYLATING GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  32  3....KQYKNYVNGEWKLS--ENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILSKEVAKGYKSAVS-EVVRTAEIINYAAEEGLRMEGEVLEGGKKKIAVVRREPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGSTGIGERIGKMAG---MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDD-ADITPLIDTKSADYVEGLINDANDKGATALTEIKR-------EGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTQRGDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK...... 475
73 -114.0003efv_A mol:protein length:462 Putative succinate-semialdehyde dehydrogenase  ali model follow..  32  1...............MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDIGQALRAHAEEMAQCITREMGKPIKQARA-EVTKSAALCDWYAEHGPAMLNPEPTLVENQQAVIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEAGTPAGVYGWVNANN-EGVSQMINDPRIAAVTVTGSVRAGAAIGAQAG-AALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDPLVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIA----GEGNYYAATVLADVTPDMTAFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFINGYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKN........ 460
74 -113.0003qan_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase 1  ali model follow..  31  36....KEYPLIINGERVT--TEDKIQSWNPARDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEADA-DTAEAIDFLEYYARQMIELNRGKEILSPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAAQNHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEGR-LMTGGEGDS----STGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQAKREFHVGNLYFNCTGAIVGYHPFGGFKMSGTDSKAGPDYLALHMQAKTVSEMYAEN.... 519
75 -113.0006dbb_A mol:protein length:511 Putative aldehyde dehydrogenase family protein  ali model follow..  25  3....MQFNDILAALDIDLAKGNALTARSPLDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKITSEGLG-EVQEMIDICDFAVGLSRQLYGLTIASEPGHRMMETWHPIGVCGVISAFNFPVAVWAWNAALAFVCGDSVVWKPSEKTPLTAIACHVLLQKAVAPAELGQLVLG-MRDVGEVLTASKKVPVVSATGSVRMGQEVAKVLS-QRLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTLVGPLVDRASFDAMQKALADAREQGGEVKGGERVDVG---HADAYYVRPAIVRMPKQSAVVERETFAPILYVMVYDNFDDAIDVHNAVPQGLSSAIFTNDMREAEQFAAGSDCGIVNVNIGTSAEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTINYSRQ.... 494

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;