current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNINLast
1 -122.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model  100  1MGSSSSGLVPRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN 302
2 -81.3004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  41  1MGSSSSGLVPRGSHMASAPAL----------TKSQTDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 285
3 -81.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  42  1MGSSSSGLVPRGSHMASAPAL----------TKSQTDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL. 285
4 -76.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  41  1MGSSSSGLVPRGSHMASAPA----------LTKSQTDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSG--CTRENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 285
5 -72.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  41  2.........................PALTKSQTDRLEVLLNPKDEI------SLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 268
6 -70.6004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  40  1.........................PALTKSQTDRLEVLLNPKDEIS------LNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCT--RENLESIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 267
7 -69.9003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  41  4......GLVPRGSHGAS-------APALTKSQTDRLEVLLNPKDEIS------LNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSG--CTRENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 282
8 -66.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  40  2.........................PALTKSQTDRLEVLLNPKDEIS------LNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSG--CTRENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL. 268
9 -61.2003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  14  102..IHINNKLRRGDIIGVQGNP----------GKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMR--IAPELYHKML----VVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFCPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQ.... 399
10 -59.9005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  14  113...VSHSEIRRGDVVGFTGFP----------GKSKRGELSLFSKSVVLLSPCYHMLPTAISGLKDQEVRYRQRYLDLMLNEESRKVFSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMR--IAPELYLKQL----IVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIGSLKIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSLPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQ.... 407
11 -59.1005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  16  105...NLHDRIKRGDIIGVNGYP----------ARSKSGELSIIPYEIIQLTPCLHMLPHTHFGLKNQETRYRMRYLDLIMNPDVKNRFSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLR--VAPELYLKML----VVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMGTYKIQYHPNGIVENPVEVDFTPPFRKVNIYDGLQEKLGIQFPPADTECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQ.... 402
12 -58.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  13  100..YELFKISDLGDIVGVRGTM----------FKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMR--IAIELHLKRL----IVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEV------LGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPV.... 384
13 -58.3001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  16  110...DQFKKWDLGDIIGARGTL----------FKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLR--IAPELYLKRL----VVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEV------LGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDASWGLGRIVTEIFDEVAEAHLIQPTFITEYPA.... 394
14 -57.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  16  110...EQFKKWDLGDILGAKGKL----------FKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLR--IAPELYLKRL----VVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDI------LGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSSWGLGRIVTEIFEEVAEAHLIQPTFITEYPA.... 394
15 -57.8006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  16  109...NWKTYVDIGDIVFVHGEV----------ITSKRGELSVLADSWQMAAKALRPLPVAHKEM-SEESRVRQRYVDLIVRDQARKVAIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLR--IAPELFLKRC----LVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGT-----RQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLGYGHGKLVEELWEHTVGAKLWAPTFVKDFPV.... 394
16 -57.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  16  124..YDAFKKWDLGDIVAARGVL----------FRTNKGELSVKCTQLRLLAKALRPLPDKFHGLADQETRYRQRYVDLIVTPETRTTFTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLR--IAPELYLKRL----IVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDA------LGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFNAGIGALQLALFEETAEAQLWEPTFIIDYPI.... 413
17 -57.5005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  16  106...RWKADVDIGDVVYVHGTV----------ISSRRGELSVLADSWRMAAKALRPLPVAHKEM-SEESRVRQRYVDLIVRPQAREVAIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLR--IAPELFLKRC----IVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGT-----RQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLVFGHGKLVEELWEHAVGNKLTAPTFVKDFPV.... 390
18 -57.1006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  14  170..IHINNKLRRGDIIGVQGNP----------GKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMR--IAPELYHKML----VVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNL-CPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQ.... 467
19 -55.9004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  13  103..AECYDKIRRGDIVGIVGFP----------GKSKKGELSIFPKETILLSACLHMLPMKY-GLKDTEIRYRQRYLDLLINESSRHTFTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLR--IATELPLKML----IVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLGTYKISYNKDGPENQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPFDSLPNPPTAAKLLDQLASHFIENKYNKPFFIVEHPQ.... 398
20 -46.4004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  14  101...SLTKMIYRGDICGFTGHP----------TRTKTGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFTKVVKAVRKYLDDKGFLEVETPILNT-----IPGGATARPFITHHNQLDIQMYMR--IAPELYLKEL----VVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGGSTKLEIK-----DRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIRISYVHALEEKFGEKIPRPLDGPEALTFLKKQAIR 417
21 -37.5001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  17  55PAYATAERVRPEWVVRAKGLVRLRP---EPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRSEELRLKYRYLD-LRRRRMQENLHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQML----MVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREA...................................................................................... 265
22 -37.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  10  1............................................................MGSSSSGLVPRGSHMSETAS-PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLM--TSPEYHMKRL----LVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLE---------IDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPA.... 231
23 -37.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  60..FAKADRVRSEFVVKITGKVRLRPEG-ARNPNMASGSIEVLGYELEVLNQATPPFPLDEYSDVGEETRLRYRFID-LRRPEMAAKLARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP--QSPQLFKQLL----MVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEV...................................................................................... 264
24 -36.3003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  14  73..PEKVKLLTRECSLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIV-IRSEHTQQVLSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYF--NEPAYLT--QSSQLYL-----ESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNV-----VHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYG----EDISEKPERQMTDEIGCPIFMIHFPS.... 350
25 -36.3004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  14  65..KKILCEAPVESVVQVSGTVISRPAG-QENPKMPTGEIEIKVKTAELLNACKKPFEIKNFVKKTEALRLQYRYLD-LRSFQMQYNLSQMVMKMREYLNLHGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLP--QSPQQFKQLL----MVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKFPTMTFAEVLATYGTDKPDTR................................................................ 297
26 -36.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  60..FEKAKKLGRESSVIVEGIVKAD--------ERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLH-IRTPKASAIMKTLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLS--QSAQLYL-----EAAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDIL---------QSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPK.... 327
27 -35.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  13  57..LKLASELRNEFCIQVTGTVRARDEK-NINRDMATGEIEVLASSLTIINRA-DVLPLDSNHVNTEEARLKYRYLD-LRRPEMAQRLAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQLL----MMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEV...................................................................................... 259
28 -35.7005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  75..LAQAHRLRAEFCVSVAGVVEIRPEG-NANPEIATGEIEVNATSLTVLGEC-APLPFQLDEPAGEELRLKYRYLD-LRRDDPAAAISRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALP--QSPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGIPRIGYAEAMRRFGTDKPDLR................................................................ 305
29 -35.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  57...AAAHRLRAEFCVAVTGVVEVRPEG-NENPEIPTGQIEVNATELTVLGESA-PLPFQLDEQAGEEARLKYRYLD-LRREGPGNALSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGLPRISYEEAMRRFGSDKPDLR................................................................ 286
30 -35.5004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  116..VKFAANINKESIVDVEGVVRKVN---QKIGSCTQQDVELHVQKIYVISLAEPRLPEEGRATVNQDTRLDNRVID-LRTSTSQAVFSGICHLFRETLINKGFVEIQTPKIISA-----ASEGGANVFTVSYF--KNNAYLA--QSPQLYKQMC----ICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQER-YTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDLEKIGGGIGLERVTMLFLGLHNVRQTS.............. 504
31 -35.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  15  73...AAAHRLRAEFCVAVTGVVEVRPEG-NENPEIPTGQIEVNATELTVLGESA-PLPFQLDEQAGEEARLKYRYLD-LRREGPGNALSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLL----MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGLPRISYEEAMRRFGSDKPDLR................................................................ 302
32 -33.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  14  57..FGISQELTQESVIQVRGIVKAD--------KRAPRGIELHAEEITLLSKAKAPLPLDVSGKVKADTRLRERVLD-LRRQEMQAVISLALKAFRETLYKEGFIEIFTPKIIASAT---EGGAQLFPVIYF----GKEAFLA--QSPQLYKEL-----MAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTI-----EGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFG--------DDIGTPELRILNEELKEDLYFIVDWPS.... 324
33 -33.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  14  87..VKWAGSLNLESIVLVRGIVKKVD---EPIKSATVQNLEIHITKIYTISETPEALPAAGLPVVNLDTRLDYRVID-LRTVTNQAIFAGVCELFREYLATKKFTEVHTPKLLGAP-----SEGGSSVFEVTY--FKGKAYLA--QSPQFNKQQL----IVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSEL--HEIELVRKQYPVEEFKLPKDGKMVRLTYKEG--EMLRAAGKEIGDFEDLSTENEKFLGKLVRD---KYDTDFYILDKFPL.... 383
34 -32.5005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  83CQCYNGVLLSTESSVAVYGMLNLTPKG-----KQAPGGHELSCDFWELIGLAPAGGADNLIEESDVDVQLNNRHMM-IRGENMSKILSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYF--GEEAFLT--QSSQLYL-----ETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRI--LKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKED---GTFYEFGEDIPEAPERLMTDTINEPILLCRFPV.... 360
35 -31.9003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  2............................................................NAMSKPFMFEKPFGMRDTL-PEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQ........................................................... 183
36 -31.8002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  11  53CQTYDALTVNTECTVEIYGAIKE-----VPEGKEAPNGHELIADFWKIIGNAPPGIDNVLNEEASVDKMLDNRHLV-IRGENAAALLAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYF--GEQSFLT--QSSQLYL-----ETCIPTLGDVFCIAQSYRAEKSRTRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRL-LADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENE---FGNTFTYGEDIAEAAERFMTDTINKPILLNRFPS.... 331
37 -31.7003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  11  1.............................................................GMSETATWQPSASIPNLLKR------AAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLM--TSPEYHMKRL----LAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLE---------IDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPA.... 218
38 -31.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1...............................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAG............................................................... 195
39 -31.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  15  60..FKLIPKLRSEDVVAVEGVVNFT--------PKAKLGFEILPEKIVVLNRAETPLPLDPTGKVELDTRLNNRFMD-LRRPEVMAIFSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYF--EEDAFLA--ESPQLYKEIM----MASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREH-YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREVI.............. 427
40 -31.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  34................................................................................PETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAG............................................................... 195
41 -31.2001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  17  47..TGGLKLPLPESALRVRGLVVEN--------AKAPGGLEVQAKEVEVLSPALEPTPPKEEWRANPDTLLEYRYVT-LRGEKARAPLAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLA--QSPQLYKQI-----MVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEA-VTRYPRSVREEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYAR.............. 411
42 -30.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  1..............................................................MYRLQIEKIRGFRDFY--PEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTS-RKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIG.................................................................. 173
43 -29.6001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  13  13................................................................................PEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTKEMYTFKDKGDRSITLRPEGTAAVVRSYIEMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNE............................................................... 177
44 -29.6003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  1.................................................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALG............................................................... 200
45 -29.4002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  6..................................................DPMAKNIQAIRGMND-------------YLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISE.................................................................................. 166
46 -29.2001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  1....................................................MRGSGSIEGRMEKINYLLPEESAEMT--LNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDL................................................ 202
47 -29.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  16................................................................................GKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNA............................................................... 179
48 -29.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  10  2..............................................NAMAKNDKINFSTPSGFPE-------------FLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLN............................................................... 198
49 -28.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  10  8LRRQMAERAALEELVKLQGER-KQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD-------------YSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDP-PDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG............................................................... 236
50 -28.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  16  1........................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDI-----PQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTKEMYSFVDALGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVE-FEWVTDKLGAQGTVAAGGRYDAACGWAMGIERILELLKEEHLVPEQEGVDVYV........ 353
51 -27.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  1..............................................................MAMSSIVAIKGFNDVL--PTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHM................................................................................. 163
52 -27.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  14  107..VQFCQKISAESICDITGIVKAVE---KPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTSQDTRLDNRMLD-LRTVTNIAIFSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFEVKYF--DRKAYLA--QSPQLYKQMA----IMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDY--------TPQEVKLGELIKAKYNTDFYILDKFPA.... 443
53 -27.2004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  25................................................................................PRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDP-PDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICG............................................................... 183
54 -26.5003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  18  2........................................................................NAVEIISRDKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL--THSMILHKQLA----IAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKA--REFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQ.............. 282
55 -26.4001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  10  6.......................................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKR--YSPDSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTM........... 195
56 -25.5006FTT Entity 1(prereleased)  ali follow..  12  12................................................................................FEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAH--HGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAA............................................................... 171
57 -25.5005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  12................................................................................FEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAH--HGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAA............................................................... 171
58 -25.3001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  17  2........................................................................NAVEI-EISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL--THSMILHKQLA----IAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAVLEEFGSDEKASQEMEEPFEVASGGEREWEYEKIVAKIRKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQ.............. 282
59 -25.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  14  24............RYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSITLMERELVEIFRALGYQAVEGPEVESEF-FDALNIPEHHPARDMWDTFEGRLLLRTHTSP----MQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIA--MAHLKGAIYELAQALFGPDSKVRVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYREGFAFGLGVERLAMLRYGIPDIRYFFGG............ 338
60 -23.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  1......................................MGSSSSGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYNFEALNLPKSHPARDMQDSITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIK--MSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVETGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNRFLEQFKAVEDR 286
61 -22.3004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  52.............................................................................ARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSHLDRLQSFRMREYVCIGDDVSDFRERWMVRAQAIARDLGLTNNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVAMFHTHGTDLSAWPAKVRDI...... 323
62 -22.1003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  14  7.......................................................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNS--ELKAYVENIFKRLGLDLHSLVVGNLSDDTALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM........................... 213
63 -22.0005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  18  132......................................................................................LGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVS--VDDGKVVAEGLLAQFGFTKFKFKPDEKKS-ETQTEVLGEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQF.......... 359
64 -21.7003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  15  7.......................................................................................YKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNS--ELKAVVEQVLCRVGIETGAYTLKTAD--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM........................... 213
65 -21.6003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  15  154...........KERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLP--DSGHLHPLLKVRSQFRQIFLEMGFTEMPTFIESSFWNFDALFQPQQHPARDQHDTFARKNLLRTHTTSSARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLT--LGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVLKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIREL............... 477
66 -21.6003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  17  52.............................................................................ARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGDDVSDFRERWMVRAQAIARDLGL-TFRVDYASDPFFGRVLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVAMFHTHGTDLSAWPAKVRDI...... 323
67 -21.3004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  4.......................................................................DGYSSYV---LLQEQILTVKRSFSEALEKENLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAI-YPNLTAKEREREIAREYLEVSSMGIRVNAEALRHQISLTGDD-FPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKKH.. 348
68 -20.4003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  12  30............EYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENVTRTIDRIESFFGELGFTVATGPEIEDDY-FDALNIPGHHPARADHDTFDTTRLLRTQTSGVQIRTMKA-----QQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNIS--FTNLKGTLHDFLRNFFEEDLQIRFRPS-FTEPSAEVDGKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFEN............ 318
69 -20.00011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  7.................................................................................AKQRQISFVKSHFSRQLEERGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGI-YDDWSTPSELNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVRES... 325
70 -20.0002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  19  122.......................................................................................EVDSKPLQEIFHRYKKGEIDGDVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCVLVDEELS--VDDGKAVAEALLRQFGFENFRFRKDEKKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQI.......... 351
71 -19.7004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  14  30............HYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSVTRTLERIEQCFSRIGYEVAEGPEVEDDY-FEALNIPGHHPARAMHDTFNANMLLRTHTSP----VQVRTMESQQPPIRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVS--FADLKGTIEEFLRAFFEKQLEVRFRPSSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDN............ 329
72 -19.5002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  10  11.................RGSHMRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIY----------------AWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGLKAIPMRAET........................................................................... 213
73 -18.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  13  219.............................................................................IHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGEEVLKCAEELHDRYMHIFNDILDIEWRKARVDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQ---SGVGLERWAAVFLAQKGLDPANWPEEFRN....... 504
74 -18.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  19  1MGSSSSGLVPRGSHMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGC-------------YILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKVADFAPEVAWVTRLAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAFATMEEAAEEVLQILDQVYEELLAIPVVKGRK............................................................................ 227
75 -17.7004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  6....................................GQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAD--RSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAFATMEEAAEEVLQILDQVYEELLAIPVVKGRKT........................................................................... 212

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.