current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRALast
1 -150.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model  100  1MGSSSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA 339
2 -140.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  92  2..............MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA 326
3 -106.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  25  150FGLKDKETRYRQRYLDLILN---DFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNI-IPGGAVAKPFITY----HNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKTPPFRRINMVEELEKALGMKLPETNLFETEETRKILAKAVECPPPRTTARLLDKLVGEFLEVTC--INPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMK. 506
4 -105.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  26  152FGLKNQETRYRMRYLDLIMN---PDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNL-IAGGATAKPFITH----HNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFENNVECPAPRTTARLLDKLIGEFLEPTF--ISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMR. 509
5 -104.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  29  158...MSEESRVRQRYVDLIVR---DQARKVARQRIAVMRAIRSALERRGFLEVETPMLQT-LAGGAAARPFVTH----SNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADDGEWESIQMYPSLSEALGEEITPDTPETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKL--WAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVK. 500
6 -103.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  26  160SGLKDQEVRYRQRYLDLMLN---EESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNM-IYGGAAARPFITY----HNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEKHEIELPHPRTAAKLLDKLAGHFVETKC--TNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMR. 514
7 -103.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  26  156....SEESRVRQRYVDLIVR---PQAREVARQRIAVIRAVRNALERRGFLEVETPMLQT-LAGGAAARPFVTH----SNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKL--TAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVR. 496
8 -103.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  28  157HGLQDQEVRYRQRYLDLIAN---DKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQV-IPGGASARPFITH----HNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHL--IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMR. 501
9 -102.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  27  157HGLQDQEARYRQRYLDLISN---DESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQV-IPGGAAARPFITH----HNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHL--IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMR. 501
10 -102.0003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  30  148HGLKDIEQRYRQRYLDLIMN---PESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHA-VAGGAAARPFITH----HNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAK-EHGVEVAPHMTFGHIVNEFFEQKVEDKL--IQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMR. 491
11 -102.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  23  150YGLKDTEIRYRQRYLDLLIN---ESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNL-IAGGANARPFITH----HNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYTPPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMIKEHKIELPNPPTAAKLLDQLASHFIENKY-NDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMR. 505
12 -100.0004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  29  172HGLADQETRYRQRYVDLIVT---PETRTTFRARTKAIASIRKFMGDADFMEVETPMLHP-IPGGAAAKPFVTH----HNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVAQPFHRLTITQAIQKYAPSYTDGQDDAFLRSELKRLGVDVTQPLNAGIGALQLALFEETAEAQL--WEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR. 520
13 -98.1006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  25  218FGLKDKETRYRQRYLDLILN---DFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNI-IPGGAVAKPFITY----HNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKTPPFRRINMVEELEKALGMKLPETNLFETEETRKILAKAVECPPPRTTARLLDKLVGEFLEVTC--INPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMK. 574
14 -83.9004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  25  148YGLGDQETRFRKRYLDLIVN---PESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILN-TIPGGATARPFITH----HNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDIEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELDFTAPFKRISYVHALEEKFGEKIPREVDLVQPTFVCDQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRP 563
15 -72.8001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  23  122...ASEELRLKYRYLDL----RRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGA-----RDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREAPFPRLSYEEAMERYGSDKPAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEK--DPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGI----GEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKE 553
16 -69.9001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  156LPVVNLDTRLDYRVIDL----RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGA-PSEGGSSVFEVTY------FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFRLTYKEGIEMLRAAGKE--IGDFEDLSTENEKFLGKLVRDKYD-TDFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAH------GLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPK 486
17 -69.4004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  186.ATVNQDTRLDNRVIDL----RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISA-ASEGGANVFTVSY------FKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEAEAGVEMGDEDDLSTPNEKLLGHLVKEKYD-TDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPK 511
18 -68.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  115...AELDTRLNNRFMDL----RRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIAT-ATEGGTELFPMKY------FEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELKLPFPRVSYDKALEILGDLGKEIPWGEDID-TEGERLLGKYMMENEN--APLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES---------EFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRR 434
19 -68.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  118YSDVGEETRLRYRFIDL----RRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGA-----RDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPANDVVDFPMFEENDDGS--LSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGI----DEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQS 562
20 -65.9001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  114.HVNTEEARLKYRYLDL----RRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGA-----RDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEGDFPVMTFAEAERRYGSDKPVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGL--TAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGI----NEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTA 559
21 -64.5004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  18  129.EQAGEEARLKYRYLDL----RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGA-----RDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATLPLPRISYEEAMRRFGSDKPDLRFGIELVECHKGLAYVLVGEDGTLGGPVAKNLSDAERDGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG 575
22 -63.9004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  18  123FVKKTEALRLQYRYLDL----RSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGA--KEFLV----PSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDPFPTMTFAEVLATYGTDKPFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKALFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILAT-------LLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR 570
23 -63.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  113.EQAGEEARLKYRYLDL----RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGA-----RDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATLPLPRISYEEAMRRF-GASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG 559
24 -63.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  15  219YVKVSQDTRLDNRMLDL----RTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGC-SSEGGSNIFEVKY------FDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKATDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT--------LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPI 544
25 -62.5003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  17  132.KDSSIPQKMQNRHIVI----RSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT-QCEGGSTLFKLQY------FNEPAYLTQSSQLY-LESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPYGEDISEKPERQMTDEIG--CPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP---------YWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYP.... 448
26 -62.5005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  19  140.EESDVDVQLNNRHMMI----RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQT-QVEGGATLFKLDY------FGEEAFLTQSSQLY-LETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTIN--EPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMPNVEIVGGSMRIFDSEEILAGYKREGIDPTP--------YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP.... 458
27 -61.6002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  17  110.EEASVDKMLDNRHLVI----RGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQT-QVEGGSTLFNLDY------FGEQSFLTQSSQLYLETCIP-TLGDVFCIAQSYRAEKRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTIN--KPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP--------YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYP.... 429
28 -61.1005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  132.EPAGEELRLKYRYLDL----RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGA-----RDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALTPIPRIGYAEAMRRFGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGL----DKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG 578
29 -60.7001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  15  111.EQASPELLLDYRHLHI----RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGA-------TLFKLKYFDKYAYLSQSAQLYLE-AAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFD--RPFFVYGYPKHIKAFYMKEDPN----DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDY-EWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPA 430
30 -60.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  112...ADIDTRLRERVLDL----RRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATGGAQLFPVIYF--------GKEAFLAQSPQLY-KELMAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYEVKIPIKRLKYTEAIEILRSKGYNIKFG-----DDIGTPELRILNEELK--EDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES---------EFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKK 425
31 -60.5001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  18  101.WRANPDTLLEYRYVTL----RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGS-------GLFGVDYFEKRAYLAQSPQLY-KQIMVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWG-SDWLFVTRYPRSVRPFYT-YPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA---------HGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRH 418
32 -49.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  17  2............NAVEI----ISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLE----------------------------EFGSDEKASQEMEEPFWIINIPREFYDR---EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS---------RPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP.... 285
33 -49.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  17  2............NAVEI----ISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILE----------------------------EFGSDEKASMEMEEPFWIVNIPREFYDR---EENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---------RPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP.... 285
34 -45.2004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11  4...........DGYSSYV-----LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRV-GDGTQDNLSGFE-VPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSE---------HQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWP.... 341
35 -43.90011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  13  1.........................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRPDELSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFAPFLPDQIHFVHSQELLSRYPDLDAKGRERAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGD--ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE---------EWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQVWP.... 319
36 -37.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  10  61QGIEHQLMSQGKRHLEQLRT-------KHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSM--ARSLSYLDGVR............................................................................................................ 298
37 -34.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  49.ELESELLSRRKKDLQQIYA-------ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSG--CTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAV---------------------VGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 283
38 -32.9002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  49.ELESELLSRRKKDLQQIYA-------ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCT--RENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAV---------------------VGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGIST................................................................................ 283
39 -32.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  49.ELESELLSRRKKDLQQIYA-------ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 271
40 -29.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  29.PFRELESELLSRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 254
41 -28.6004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  28.PFRELESELLSRRKKDLQQIYAEERENYL---GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 253
42 -28.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  44..FRELESELLSRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRK---KIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSG--CTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAL---------------------VGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 280
43 -21.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  30..FRELESELLSRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL........................................................................................................................................................................................... 184
44 -13.2003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  35...........................EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLS---KSIDEIAQRVGEEHEAVKELRQFFEQVEVVRGLAYYTGIVFEGFDREGKFRALCGGGR------DNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDI........ 352
45 -13.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  10  35...........................DFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWA-KAAESTQVGIERMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDVVTFDLALHRELDYYTGLVFEMFAPGVGAPI-PAVGFAFEVERVMAVLEAQEEGEG......... 371
46 -12.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  20..MEKLNQQLAEETIDVTLPSRQISI-GSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQD-----NFEALNLPKSHPARDMQDSFYIRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDATHSHQFTQIEGLVVNIKMSDLKGTLELVAKKLFGADREIR---------------------------------------------LRPSYFPFTEPSVEVD--VSCFKCKGKGCNVCKHTG--------IEILGAGM-----------------------------------VHPNVLEMAGFDSNEYSGFGMGPDRIAMLKYGIEDIRYF........ 269
47 -12.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  18...........................EDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDRWYSFPKVWRYEEPQAGRYREHYQFNA---------------DIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVGIDEMARITGKSSEEIARMAAVEDLLAIVRGLSYYTGIVFEAYDRSGQFRAILGGGR------DNLASLMSGESVPAVGFGMGDAVISLLLKREN............. 325
48 -12.8004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  17...........................KELRMHQRIVATARKVLEAAGALELVTPIFEET-GVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEH--RLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKYNAYLREVLS-PHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAEVHHEEIGAQSALGGGGRY------------------DGLSELLGGPRVPGVGFAFGVERVALALEAEG............. 322
49 -12.7003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  22...........................EWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPAEFEQLG----------------ELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVG--YVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGAS---------EYVKFDLTLVLHMSYRPAQATGFGVRIDLLVEALNGEIISNGHEQT..... 339
50 -12.6001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  11  14...........................EDSKKWRYIENQLDELMTFYNYKEIRTPIFEST-GVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEH--KLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLV--INSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKE-----AIKTAPRITDFLNEESKAYYEQVKAY--YTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYN-GLLELLDGPSETGIGFALSIERLLLALEEEG............. 321
51 -12.6003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  11  24...........................SEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLYQMDVVFRGERAKDGRFRQFRQCDIDVVGRE-AQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGR-----EELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTL........ 367
52 -12.5003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  35...........................ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLS---KTIDEIAQRIGEEHEAVRELRDFITQIEVVRGLAYYTGIVFEGFDRDGNFRALCGGGR------DNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPEL........ 352
53 -12.2004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  79...........................RQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRD------NPAMTR-EFYQCDFDIAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRK---PCVGLSIGVERIFSIVEQRLEALE......... 412
54 -12.1004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  26...........................RQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRG---RYREFYQCDFDIAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRK---PCVGLSIGVERIFSIVEQRLEALE......... 359
55 -11.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  24...........................GETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQT-AIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH--RLWYIGPMFRHERPQKGRYRQF-----HQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQA-LLNDAPALGDYLDEESREHFAGLCKL--YTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGR-----DGLVEQLGGRATPAVGFAMGLERLVLLVQAVN............. 327
56 -11.8001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  17  104.................................TLMERELVEIFRALGYQAVEGPEVESEPEHHPARDMWDTFWLTGEGEVEGRLLLRTHTSPMQVRYMVAHTPRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGIAMAHLKGAIYELAQALFGPDSKVRF------------------------------------------------------------QPVY---FP--VEPGAQFAVWWPEGGKWLELGGAGM----VHPKVFQAVDAYRERLGLPPAYRG---------------------TGFAFGLGVERLAMLRYGIPDIRYFF....... 336
57 -11.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  18...........................TQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQT-AIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTVRALVEHNLLRVWYMGPMFRYEKPQKGRYRQF-----HQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQK-ILENAPKLHDFLKEDSLSHFQQLQDY--FVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAV-GFAMGMERLLLLLEQVEQAEI......... 330
58 -10.9003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  228.................................LKVRSQFRQIFLEMGFTEMDTFFLRDPAEALQLPMDYVQRVKRTHSQEARKNLLRTHTTSASARALYR---KYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLT--LGHLMGVLREFFTKLGITQLRFKPAY-------------------------------------------------------------NP--TEPSMEVFSYHQGLKKWVEVGNSGV-----------------------------------FRPEMLLPM--GLPE--AWGLSLERPTMIKYGINNIREL........ 477
59 -10.9001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  28...........................NQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDRYSYFGKIFRKEKRHKGRSTENYQIELFGESADKSEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLDGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISMIKPIIIDLGMVPKMD-YYTDLMFKAYSSAANQPILSGGRY------------------DQLLSNFQEEAF-AIGFCCHMDTILKALERQELEED......... 336
60 -10.7006FTT Entity 1(prereleased)  ali follow..  13...........................EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTPLQAEIFGCESIAADLIDVLFSMINSLVLHVDLGHVTIFKRLAELAALSASDTEQMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQR-DVTELSGYH-YHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVL........ 328
61 -10.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13...........................EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTPLQAEIFGCESIAADLIDVLFSMINSLVLHVDLGHVTIFKRLAELAALSASDTEQMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQR-DVTELSGYH-YHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVL........ 328
62 -10.4004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  38...........................QDAGLWEFFEATVKSLLRAYGYQNIRTPIVE-------HTPLFTRGIGEVTDIVEKEMYLTLRPENTVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNALIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVEWVTDKLGAQGTVAAGGRY------------------DPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE......... 345
63 -10.4003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  16  110.................................TRTIDRIESFFGELGFTVATGPEIEDD-----NFDALNIPGHHPARADHDTFWFDTTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNIS--FTNLKGTLHDFLRNFFEEDLQIR---------------------------------------------------------RPSY---FPFTEPSA--------------EVDVM----NGKWLEVLGCGMVHPNV-----------LRNVGIDPEVYSGFAFGM--------GMERLTMLRYGVTDLRSFF....... 316
64 -10.2001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  13  5KGLTPQSQDFSEWYLEVIQKAELADYGPVYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFEAEHVEGFSPELAAGGEELEEPLAVRPTSETVIGYMWSKWIRLLNQWGNVVRWE-RPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSIGAIIMTHGDDPPRLAPIQVVIVPIYKDESRERVLEAAQGRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVP------------FRVELGPKDLEG......... 357
65 -10.0002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  35...VSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNT-----RGIEVGQIFY---------TKYSD-------------SMKANVTGPDGTDAPIHGGYGVGVSRLLGAIIEACHDDNGIIWPEAVA 358
66 -9.9506blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  14  214...........................DLVRMNLALQNYAIDFLAKKGYMPIYTPFMTKEQMKKVAQLSQFDEELYTVTGEGEDKYLIATSEQPIAAFHLEKR-KYCGMSTCFRKEGIFRVH--QFEKIEQFKSWEMFDEMIGNSEAFYQSL----------------------------------------------------------------------PYRVVNIVSGALNNAAAKKFD------LEAWFPGADEGNEYRELVSCSNQTRRLEVKYGKSKKQGSEV-----EFCHMLN-------STLTATSRTLCCIVENYQTPEGVNVP.... 462
67 -9.8603ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  13  49.............................FFMENAIMRLCEEEYAKVGISQILFPTVIPESFESDHIKGFEAECKGGLQPLEERLALRPTSETAIYSMFSKWVRKIHQTCTIFRHETKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAPPLIAPIIPIGCGKKNNQESDQ------QVLGKVNEIADTLKSKLGLRVSIDDDFS-----KSMGDKLYYYELKGVP------------LRIEVGQRDLAN......... 369
68 -9.2604hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  10  4.GEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYFDAEIKKLGVENCYFPMFVSQSALEKEAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQKLNQWCNVVRWEPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEK--GDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNTRTIGVMTMVHGDNPPRVACVQVVI--IPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRFNHWELKGVP------------IRLEVGPRDMKS......... 377
69 -9.1601nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  11  38.............................FKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKKIYQIVNTFRYETKHTRPLREIMTFEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLIS-KRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASI----PPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYE-KLKGKFRVHIDDRDIRPGRKFNDWEIKGVP------------LRIEVGPKDIEN......... 350
70 -9.1304p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  14  110.................................TRTLERIEQCFSRIGYEVAEGPEVEDD-----NFEALNIPGHHPARAMHDTFYFRTHTSPVQVRTMESQQPRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVS--FADLKGTIEEFLRAFFEKQLEVR-----------------------------------------FRPSFFPFTEPSAEVD--IQCVICSGNGCRVCKQTG--------LEVMGCGM-----------------------------------VHPNVLRMSNIDPEKFQGFGMGAERLAMLRYGVNDLRLF........ 326

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.