current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3e0e_A mol:protein length:97 Replication protein A, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MNYKISELMPNLSGTINAEVVTAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLLast
1 -55.4003e0e_A mol:protein length:97 Replication protein A  ali model  100  1MNYKISELMPNLSGTINAEVVTAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSL 97
2 -51.8002k5v_A mol:protein length:104 Replication protein A  ali model follow..  98  1MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKS. 96
3 -44.7003dm3_A mol:protein length:105 Replication factor A  ali model follow..  44  5.TYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLTDIDVGRGDYVRVRGIREGYYGGLECTANYVEILKKG. 100
4 -39.3002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  20  7.MDTISKLEEGAETPVTGRVMKISSPRTFTTRKGREGKLANVIIADDTGELRAVFWTENIKKKFREGDVIRIKD--GGFGGRKEAHLMPRSTVEVL. 105
5 -36.9002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  19  1MEEKVGNLKPNMEVNVTVRVLEASEARQIQTKNG-VRTISEAIVGDETGRVKLTLWGKHAGS-IKEGQVVKINAWTTAFKGQVQLNAGSKTKIAEA. 96
6 -36.5001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  19  1MEEKVGNLKPNMEVNVTVRVLEASEARQIQTKNG-VRTISEAIVGDETGRVKLTLWGKHAGS-IKEGQVVKINAWTTAFKGQVQLNAGSKTKIAEA. 96
7 -35.7001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  22  16.FVKVEQLKPGTTHTLTVKVIEANIVVPVTRRPSQPSRIVECLIGDETGCILFTARNDQVDL-MKPGATVILNSRIDMFKGTMRLGVDKWGRIEAT. 120
8 -33.9005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  18  4.ETFVKDIKPGLKLNLIFIVLETGRVTKT----KDGHEVRTCKVADKTGSINISVWDDVGNL-IQPGDIIRMKGYASVFKGCLTLYTGRGGDLQKI. 95
9 -33.5002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  20  3.LVKIRDVSLSTPVSVIGKITGIHKKE--YESDGTTKSVYQGYIEDDTARIRISSFGKQ----LQDSDVVRINARVAQFNGYLSLSVGDSSRIESV. 93
10 -32.9002kbn_A mol:protein length:109 Conserved protein  ali model follow..  21  5.LTKIVDIVENGQANLKAKVIQLWENT-------HESISQVGLLGDETGIIKFTIWKNAELPLLEQGESYLLSVVVGEYNDRFQVQVNKNSSIEKL. 94
11 -29.8002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  3.HMQVTPRRNVQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDS---LLEVNEESTVSEA. 95
12 -26.4003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  10  1..GSVDSIREGQKRCLPVMVLKAKKPFTFETQEG-KQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSG---FLEVNSASRVLDA. 91
13 -25.9004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  14  97.TPRISKLKIQPCGTIVNGLFKV-------QKITEEKDRVLYGIHDKTGTMEVLVLGNPSKTKCEEGDKIRLTFEVSKNGVKIQLKSGPCSFFKV.. 184
14 -24.7004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  18  5..TFVKDIKPGLKLNLIFIVLETGRVTKT----KDGHEVRTCKVADKTGSINISVWDDVGNL-IQPGDIIRLKGYASVFKGCLTLYTGRGGDLQKI. 95
15 -22.7004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  13  111.HLKICDLHLQTEERLVDGEFKVYRKSS-------GNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCELTSNADEWFLRATRYSYME... 197
16 -20.4001ynx_A mol:protein length:114 Replication factor-A protein 1  ali model follow..  25  4.IFAIEQLSPYQVWTIKARVSYKGEIKTWHNQRG-DGKLFNVNFLDTSGEIRATAFNDFATKILQEGKVYYVKPQFTNLTHPYELNLDRDTVIEEC. 109
17 -19.9004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  21  111.TLKISKIKELDSGTLIYGVFAVEKKKV-------NDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK... 197
18 -19.5004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  20  111.TLKISKIKELDSGTLIYGVFAV-------EKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK... 197
19 -18.5004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  21  107.TLKISKIKELDSGTLIYGVFAVEKKKV-------NDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK... 193
20 -17.4001jmc_A mol:protein length:246 PROTEIN (REPLICATION PROTEIN A (RPA))  ali model follow..  17  131...DLENKSKDSLVDIIGICKSYEDATKITRSNNREVAKRNIYLMDTSGVVTATLWGEDADKDGSRQPVLAIKGARVSDFGGRSLSVLSSSTI.... 223
21 -17.4001fgu_A mol:protein length:252 REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT  ali model follow..  25  4.VVPIASLTPYQKWTICARVTNKSQIRTWSNSRG-EGKLFSLELVDESGEIRATAFNEQVDKLIEVNKVYYFNKQFTAVKNDYEMTFNNETSVMPC. 109
22 -14.7004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  18  37...........KQVDVLGTVIGVRERDAF----------YSYGVDDSTGVINCICWKKLNTESIEIGDTIRVRGSIRTYREEREIHATTYYKVD... 138
23 -14.5004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  27  3.IYPIEGLSPYQRWTIKARVTSKSDIRHWSNQRG-EGKLFSVNLLDDSGEIKATGFNDAVDRLLQENHVYLIKKQFSNLQNEYEITFENSTEIEEC. 108
24 -14.4003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  12  12..TPLNQLKGGTIVNVYGVVKFFKPPYLSKGTD-----CSVVTIVDQTNVLTCLLFSGNYEAIYKNGDIVRFHRKIQVYKKETQGITSSGFAS.... 103
25 -14.4003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  13  56...........AAVWMQGRVVMADR--------------GEARLRDPSGDFSVRGLERVPRGRLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDN. 128
26 -14.1003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  13  59...........AAVWMQGRVVMADRG--------------EARLRDPSGDFSVRGLERVPRGRLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSD.. 130
27 -14.1003kf8_A mol:protein length:220 Protein stn1  ali model follow..  15  84.........PVNQINIFGKIVYEQYKEKEFNGVEESYVI--LVISDFIGIDSKIRVRLSQEQKKNYGKIVELEGEIYNWYDSINVSKKPDRELK... 175
28 -13.9001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  19  28.VESAKSLRDDTWVTLRGNIVERISDDLY-------------VFKDASGTINVDIDHKR-GVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVNP.. 109
29 -13.9004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  16  37...........GQLTFVAVVRNIS----------RNATNVAYSVEDGTGQIEVRQWLDSSSDDIRNNVYVRVLGTLKSFQNRRSISSGHMRPVI... 115
30 -13.1003kf6_A mol:protein length:159 Protein stn1  ali model follow..  14  46.........PIRWIQIVGYIAAIDIYEGKHV----------LTVDDCSGMVLRVVFIIQDDFSMSPGNVVCVFGKINSFRSEVELIAQSFEELR... 127
31 -13.1002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  15  49..CTISQLLSATQVTIVGIIRHAE----------KAPTNIVYKIDDMTAAPMDVRQWVDTDDTVPPETYVKVAGHLRSFQNKKSLVAFKIMPLED.. 151
32 -12.3001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  13  40........KKNTIVNLFGIVKDFTPSRQ--SLHGTKDWVTTVYLWDPT-GLQIHLFSKQGNDIKQVGQPLLLHQTLRSYRDRTQGLSKDQFR..... 130
33 -11.6001jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  13  39..VELAKASLAQPQHFYAVVIDATFPYKTNQER-----ICSLKIVDPTDYATLVLYAKRFEDLHRAGDIIRVHRTLRLYNGQRQFNANVFYSSSWAL 148
34 -11.6006d6v_D mol:protein length:701 Telomerase-associated protein 82  ali model follow..  360..QKNNKYRQNNNSEVLKTSKQYLSVLAVVDIQSSDKNIRLKICDNSCNELKVVIFPDLCYEKFSINKWYYFNEVRQIYNDEVQLKNNIHSSI.... 464
35 -10.6004hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  20  8....LSQITPHQRCSFYAQVIKTW----------YSDKNFTLYVTDYTENIRCILWDEHDFNYIKEGDYVVMK--------NVRTKIDHLGYLECIL 108
36 -10.4004gla_C mol:protein length:109 OBody NL8  ali model follow..  18  13...EITPNLHGTEVVVAGWVASLGD----------YGRVKIVKVSDREGGAAVPVYLEAGKAELSREDVVVIKGIVEASKRGVEIFPSEIWILNKA. 107
37 -9.7601x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  16  7.CQEVKPELDGKKVRLAGWVYTNM----------RVGKKIFLWIRDSTGIVQAVVAKNVVGEELGRESSVIVEGIVKADEGGAEVHVEKLEVIQAV. 101
38 -9.6304gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  18  12...EITPNLHGSEVVVAGWVAHLGD----------YGRVKIVKVSDREGGAAVPVYLERGKAELSREDVVVIKGIVEASATGVEIFPSEIWILNKA. 108
39 -9.6101n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14  1MRVLVRDLKAGQEVELLGFLHWRR----------DLGRIQFLLLRDRSGVVQVVT---GGLKLPLPESALRVRGLVVENAGGLEVQAKEVEVLSPA. 88
40 -9.6004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  18  11...EITPNLHGSEVVVAGWVAHLGD----------YGRVKIVKVSDREGGAAVPVYLERGKAELSREDVVVIKGIVERWDTGVEIFPSEIWILNKA. 107
41 -9.2201b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  19  6YSSEITEELNGQKVKVAGWVWEVK----------DLGGIKFLWIRDRDGIVQITAPKKKVDPELRSEDVVAVEGVVNFTPKGFEILPEKIVVLNRA. 101
42 -9.2202wkc_A mol:protein length:119 ORF34P2  ali model follow..  15  8..................AQANEKNTRTVSTAKGDKKIIS--VPLFEKEKGSNVKVAYGSADFIQLGDTVTVSGRVQA................... 68
43 -9.1404gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  11...EITPNLHGSEVVVAGWVAHLGD----------YGRVKIVKVSDREGGAAVPVYLERGKAELSREDVVVIKGIVEA-DTGVEIFPSEIWILNKA. 107
44 -9.1104j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  62.VRDLTIQKADEVVWVRARVHTSR----------AKGKQCFLVLRQQQFNVQALVAVGDHAANINKESIVDVEGVVRKVNQDVELHVQKIYVISLAE 163

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.