current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3ers_X mol:protein length:118 tRNA-binding protein ygjH, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVVLDLast
1 -73.8003ers_X mol:protein length:118 tRNA-binding protein ygjH  ali model  100  1METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVVLD 112
2 -66.4002cwp_A mol:protein length:112 MetRS related protein  ali model follow..  31  5.ELYDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIADQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETEDG-KVYLIPVPEEVPVGARVW.. 112
3 -65.9001pyb_A mol:protein length:111 methionyl-tRNA synthetase beta subunit  ali model follow..  28  5.ALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGEN--LSVIVPDRDVKEGAKLS.. 111
4 -64.6005h34_A mol:protein length:135 Methionine-tRNA ligase  ali model follow..  49  23.GLVSYLDFAKLDMRVGKIIDVQDHPNADKLYIIKVSLGNKQKTLVGGLKQYYKKEELIGKYVVLINNLKPKQLRGITSEGMLLAADDGK--EVALLMPDKPISLGSKV... 128
5 -60.8001ntg_A mol:protein length:172 Tyrosyl-tRNA synthetase  ali model follow..  39  1..EPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGIRQVEPLDPPAGSAPGEHVFVK 112
6 -60.6002q2h_A mol:protein length:131 Secretion chaperone, phage-display derived peptide  ali model follow..  28  21.GEISYADFEKVDIRVGTIVEAVPFPEARKPAKVKIDFGPEIKKSSAQITVHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGFADANG-DIVLAAVERPVPNGEKMC.. 131
7 -59.8001e7z_A mol:protein length:174 ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II  ali model follow..  36  5.......DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPE--KIEILAPPNGSVPGDRITFD 108
8 -59.5002q2i_A mol:protein length:116 Secretion chaperone  ali model follow..  28  6.GEISYADFEKVDIRVGTIVEAVPFPEARKAIKVKIDFGPEIKKSSAQITVHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGFADANG-DIVLAAVERPVPNGEKMC.. 116
9 -59.0003g48_A mol:protein length:112 Chaperone CsaA  ali model follow..  23  3.AMANFEDFLTLDLRIGTVTHAEEFKEARPAIRLEIDFGEGMKQSSAQITKRYNPEDLIGQQIVAVVNFPPKRVAGFKSEVLVLGGVPEAG-DVVLLQPNMELPNGTKIS.. 112
10 -58.6001gd7_A mol:protein length:109 CSAA PROTEIN  ali model follow..  32  2...TPLEAFQILDLRVGRVLRAEPHEKARKSYKLWVDLGPGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAG-RVVLLAPDREVPLGGKVF.. 109
11 -58.0002nzh_A mol:protein length:113 Protein csaA  ali model follow..  25  3.HMAVIDDFEKLDIRTGTIVKAEEFPEARVAIKLVIDFGTEIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQG-DVVLLQPDQPVPNGTKI... 112
12 -56.6004r1j_A mol:protein length:197 GU4 nucleic-binding protein 1  ali model follow..  29  14.HMPEKPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDD--KVEFVEPPKDSKAGDKVFFE 124
13 -52.0004r3z_A mol:protein length:312 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1  ali model follow..  34  145.ADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPE--KIEILAPPNGSVPGDRITFD 254
14 -50.1001rqg_A mol:protein length:722 Methionyl-tRNA synthetase  ali model follow..  46  616.MYVKFDDFAKLDLRVGKIIEVKDHPNADKLYVVKVDLGDEVRTLVAGLKKYYKPEELLNRYVVVVANLEPKKLRGIGSQGMLLAADDGER--VALLMPDKEVKLGAKV... 721
15 -27.7002e8g_A mol:protein length:241 Hypothetical protein PH0536  ali model follow..  21  136...........VDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTN------DLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGE-KNVKGEIGGLPKGIPLEALN... 229
16 -21.6003bu2_A mol:protein length:199 Putative tRNA-binding protein  ali model follow..  21  92............KFVVGYVETKDKHPDADKLSVLSVDVATEKLQIVCGAPNVEAGQKVVGAVMPSGMVIKDAELRGVASSGMICSMKENAPQEKGIMVLSDDYTVGQSF... 196
17 -20.0004p71_A mol:protein length:792 Phenylalanine--tRNA ligase beta subunit  ali model follow..  26  32VDADLPVAGAFSGVVVGEVLSTEQHPDADKLRVCQVSNGSETFQVVCGAPNVRAGLKIIGAELPDDFKIKKAKLRGVESFGMLCSAKE-SEENAGLLELPADAPVGQDV... 146
18 -18.9004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  37  610......LDGFQLEIRVGKIVEAGPHPNSEHLLALKVDVGEEPRSVVAGLAEHYKPEELLNQKATFVCNLKPSKLRGVASEAMILAATSLDGTKVKFCHPSADAAIGAQVI.. 714
19 -18.3002rhs_B mol:protein length:800 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  23  32VDNMIDYSKDIKNLVVGYIQSKEKHPDADKLNICQVDIGEEPVQIVCGAPNVDAGQHVVGGRLPGGIKIKRAKLRGERSEGMICSLQEPKAYENGIFVFPTEVEPGTDA... 153
20 -17.9003pco_B mol:protein length:795 Phenylalanyl-tRNA synthetase, beta chain  ali model follow..  26  32VDGVEPVAGSFHGVVVGEVVECAQHPNADKLRVTKVNVGGRLLDIVCGAPNCRQGLRVIGAVLPGDFKIKAAKLRGEPSEGMLCSFSE-SDDHSGIIELPADAPIGTDI... 147
21 -13.6001b70_B mol:protein length:785 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  32TDRIERVFPIPRGVVFARVLEAHPIP-GTRLKRLVLDAG-RTVEVVSG-----AENARKGIGVALALKVGERVIQGVRSFGMALSPREGEYGGGLLEFPEDALPPGTPL... 146
22 -13.0005cot_A mol:protein length:340 Naegleria gruberi RNA ligase  ali model follow..  17  8.............ATIRTAGEITPIAGAEAIECCHVDVIKKGEFKQGDRGVYFEIDSFIKEDNDRYPMLRTARLRGQLSQGLFLPMDR........................ 101

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.