current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst GMSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRALast
1 -147.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model  100  1GMSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA 326
2 -140.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  92  15.MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA 339
3 -100.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  26  169.........NDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNI-IPGGAVAKPFITY----HNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIPFRRINMVEELEKALGMKLPETNLFETEETRKILAKAVECPPPRTTARLLDKLVGEFLEVTC--INPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMK. 506
4 -99.7006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  30  174.........RDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQT-LAGGAAARPFVTH----SNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAEWESIQMYPSLSEALGEEITPDTPAELWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKL--WAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVK. 500
5 -99.4005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  28  171.........RPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQT-LAGGAAARPFVTH----SNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKL--TAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVR. 496
6 -99.1005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  28  171.........NPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNL-IAGGATAKPFITH----HNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFENNVECPAPRTTARLLDKLIGEFLEPTF--ISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMR. 509
7 -97.8005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  28  179.........NEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNM-IYGGAAARPFITY----HNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEKHEIELPHPRTAAKLLDKLAGHFVETKC--TNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMR. 514
8 -97.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  30  176.........NDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQV-IPGGASARPFITH----HNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHL--IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMR. 501
9 -96.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  30  176.........NDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQV-IPGGAAARPFITH----HNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDIPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHL--IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMR. 501
10 -96.7003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  31  167.........NPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHA-VAGGAAARPFITH----HNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAK-EHGVEVAPHMTFGHIVNEFFEQKVEDKL--IQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMR. 491
11 -96.6004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  25  169.........NESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNL-IAGGANARPFITH----HNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMIKEHKIELPNPPTAAKLLDQLASHFIENKY-NDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMR. 505
12 -94.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  30  191.........TPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHP-IPGGAAAKPFVTH----HNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDAPFHRLTITQAIQKYAPSYTDDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQL--WEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR. 520
13 -92.8006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  26  219GLKDKET-LNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNI-IPGGAVAKPFITY----HNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIPFRRINMVEELEKALGMKLPETNLFETEETRKILAKAVECPPPRTTARLLDKLVGEFLEVTC--INPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMK. 574
14 -78.5004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  26  167.........NPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILN-TIPGGATARPFITH----HNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDIEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELDFTAPFKRISYVHALEEKFGEKIPREVDLVQPTFVCDQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRP 563
15 -69.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  22  136........RRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGA-----RDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREAPFPRLSYEEAMERYGSLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGEAWTYMHHPFTSPHPEDLPLLEK--DPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGI----GEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKE 553
16 -68.5001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  16  173........RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGA-PSEGGSSVFEVTY------FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLT-RAAGKEIGDFEDLSTENEKFLGKLVRDKYDT-DFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAH------GLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPK 486
17 -68.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  129........RRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIAT-ATEGGTELFPMKY------FEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELKLPFPRVSYDKALEILGDLGKEIPWGEDID-TEGERLLGKYMMENEN--APLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES---------EFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRR 434
18 -68.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  202........RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISA-ASEGGANVFTVSY------FKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEAEAGVEMGDEDDLSTPNEKLLGHLVKEKYD-TDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPK 511
19 -64.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  135........RRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGA-----RDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVEFPHMPFEEAMRRYGADKAKIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPMFEENDDGS--LSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGI----DEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQS 562
20 -62.4001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  22  130........RRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGA-----RDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEGDFPVMTFAEAERRYGSDKPVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGL--TAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGI----NEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTA 559
21 -62.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  16  236........RTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGC-SSEGGSNIFEVKY------FDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFPFLRLTYKEAIEMLRASGETIGDYDDFT-TPQEVKLGELIKAKYN--TDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT--------LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPI 544
22 -62.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  19  156........RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQT-QVEGGATLFKLDY------FGEEAFLTQSSQLY-LETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRIAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTIN--EPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMPNVEIVGGSMRIFDSEEILAGYKREGIDPTP--------YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP.... 458
23 -62.1003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  17  148........RSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT-QCEGGSTLFKLQY------FNEPAYLTQSSQLY-LESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNV--DKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGIL-NKDKPFEYGEDISEKPERQMTDEIG--CPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP---------YWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYP.... 448
24 -61.3002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  18  126........RGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQT-QVEGGSTLFNLDY------FGEQSFLTQSSQLYLETCIP-TLGDVFCIAQSYRAEKRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTIN--KPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP--------YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYP.... 429
25 -61.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  19  145........RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGA-----RDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTLGGPVAKNLSDAERDGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG 575
26 -60.2001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  18  126........RRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATGGAQLFPVIYF--------GKEAFLAQSPQLY-KELMAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFG-----DDIGTPELRILNEELK--EDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES---------EFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKK 425
27 -59.9004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  129........RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGA-----RDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG 559
28 -59.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  16  127........RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGA-------TLFKLKYFDKYAYLSQSAQLYLE-AAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFD--RPFFVYGYPKHIKAFYMKEDPN----DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDY-EWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPA 430
29 -59.6001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  18  117........RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGS-------GLFGVDYFEKRAYLAQSPQLY-KQIMVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWG-SDWLFVTRYPRSVRPFYT-YPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA---------HGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRH 418
30 -59.5004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  140........RSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGA--KEFLV----PSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNVPFPTMTFAEVLATYGTDKPFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKALFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILAT-------LLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR 570
31 -57.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  148........RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGA-----RDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALTPIPRIGYAEAMRRFGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGL----DKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG 578
32 -50.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  7........ISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEV-----------------------------EEFGSDEKASQEMEEPFWIINIPREFYDR---EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS---------RPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP.... 285
33 -49.9003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  18  7........ISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDI-----------------------------EEFGSDEKASMEMEEPFWIVNIPREFYDR---EENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---------RPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP.... 285
34 -44.8004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  11..........LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRV-GDGTQDNLSGFE-VPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILP-ETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRASQVVFPRTSKPIPTMNSLSSLKGLNGDILLDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSE---------HQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWP.... 341
35 -44.40011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  13  1............MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRPDELSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFAPFLPDQIHFVHSQELLSRYPDLDAKGRERAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGD--ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE---------EWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQVWP.... 319
36 -34.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  69..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSG--CTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAV---------------------VGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 283
37 -31.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  69..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCT--RENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAV---------------------VGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGIST................................................................................ 283
38 -31.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  11  62GIEHQLMSQGKRHLEQLRTVLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSM--ARSLSYLDGVR............................................................................................................ 298
39 -30.9004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  69..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 271
40 -30.1005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  52..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 254
41 -29.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  66..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRK---KIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSG--CTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAL---------------------VGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 280
42 -27.3004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  51..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCT--RENLESIITDF-----------------------------------------------------------------------------------LNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA........ 253
43 -21.8004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  22  52..............ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL........................................................................................................................................................................................... 184
44 -13.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  28GMQDG---------DFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWA-KAAESTQVGIEREASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDS--------GLASDVVTFDLALHRELDYGL-PAVGFAFEVERVMAVLEAQEEGEG......... 371
45 -13.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  35..............EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLS---KSIDEIAQRVGEEHEAVKELRQFFEQVEVVRGLAYYTGIVFEGFDREGKFRALCGGGR------DNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDI........ 352
46 -13.5004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  10GTKDLFG-------KELRMHQRIVATARKVLEAAGALELVTPIFEET-GVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEH--RLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAEVHHEEIGAQSALGGGGRY------------------DGLSELLGGPRVPGVGFAFGVERVALALEAEG............. 322
47 -13.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  4.MSKPFMFEKPFGMRDTKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPAEFEQLG----------------ELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHV--GYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGAS---------EYVKFDLTLVLHMSYHRPQATGFGVRIDLLVEALNGEIISNGHEQT..... 339
48 -13.2001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  18..............EDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDRWYSFPKVWRYEEPQAGRYREHYQFNA---------------DIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVGIDEMARITGKSSEEIARMAAVEDLLAIVRGLSYYTGIVFEAYDRSGQFRAILGGGR------DNLASLMSGESVPAVGFGMGDAVISLLLKREN............. 325
49 -13.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  15  50....................TRTVEEIEDLFLGLGYEIVDGYEVEQD-----NFEALNLPKSHPARDMQDSFYIRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDATHSHQFTQIEGLVVNIKMSDLKGTLELVAKKLFGADREIR---------------------------------------------LRPSYFPFTEPSVEVD--VSCFKCKGKGCNVCKHTG--------IEILGAGM-----------------------------------VHPNVLEMAGFDSNEYSGFGMGPDRIAMLKYGIEDIRYF........ 269
50 -13.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  14..............EDSKKWRYIENQLDELMTFYNYKEIRTPIFEST-GVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEH--KLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLV------INSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKE-AIKTAPRITDFLNEESKAYYEQVKAY--YTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYN-GLLELLDGPSETGIGFALSIERLLLALEEEG............. 321
51 -13.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  35..............ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLS---KTIDEIAQRIGEEHEAVRELRDFITQIEVVRGLAYYTGIVFEGFDRDGNFRALCGGGR------DNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPEL........ 352
52 -12.9003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  24..............SEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQAIITEIFEAVNIGDFVIRTGFFQSLNISETQIKCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGR-----EELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTL........ 367
53 -12.6002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  17GMNDYLP-------GETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQT-AIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH--RLWYIGPMFRHERPQKGRYRQF-----HQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQA-LLNDAPALGDYLDEESREHFAGLCKL--YTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGR-----DGLVEQLGGRATPAVGFAMGLERLVLLVQAVN............. 327
54 -12.6005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  11GFNDVLP-------TQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQT-AIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTVRALVEHNLLRVWYMGPMFRYEKPQKGRYRQF-----HQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQK-ILENAPKLHDFLKEDSLSHFQQLQDY--FVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAV-GFAMGMERLLLLLEQVEQAEI......... 330
55 -12.3001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  104....................TLMERELVEIFRALGYQAVEGPEVESEPEHHPARDMWDTFWLTGEGEVEGRLLLRTHTSPMQVRYMVAHTPRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIA--MAHLKGAIYELAQALFGPDSKVR-----------------------------------------FQPVYFPFVEP---------------------------------------GAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGF----AFGLGVERLAMLRYGIPDIRYFF....... 336
56 -12.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  79..............RQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRD------NPAMTYREFYQCDFDIAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRK---PCVGLSIGVERIFSIVEQRLEALE......... 412
57 -12.2004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  26..............RQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRG---RYREFYQCDFDIAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRK---PCVGLSIGVERIFSIVEQRLEALE......... 359
58 -11.5001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  11.MEKINYLLPEESAEMTKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDRYSYFGKIFRKEKRHKGRSTENYQIELFGESADKSEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLDGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISMIKPIIIDLGMVPKMD-YYTDLMFKAYSSAANQPILSGGRY------------------DQLLSNFQEEAF-AIGFCCHMDTILKALERQELEED......... 336
59 -11.3003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  228....................LKVRSQFRQIFLEMGFTEMDTFFLRDPAEALQLPMDYVQRVKRTHSQEARKNLLRTHTTSASARALYR---KYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLT--LGHLMGVLREFFTKLGITQLRFKPAY-------------------------------------------------------------NP--TEPSMEVFSYHQGLKKWVEVGNSGV-----------------------------------FRPEMLLPM--GLPE--AWGLSLERPTMIKYGINNIREL........ 477
60 -11.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  31GMNDILP-------QDAGLWEFFEATVKSLLRAYGYQNIRTPIVE-------HTPLFTRGIGEVTDIVEKEMYLTLRPENVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNALIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVEWVTDKLGAQGTVAAGGRY------------------DPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE......... 345
61 -11.1006FTT Entity 1(prereleased)  ali follow..  10  6GVADV---------EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTP-----LQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAID-YHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVL........ 328
62 -11.1005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  6GVADV---------EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTP-----LQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAID-YHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPR----------------QATGFSMDVSRLLAHTQLDAPFIVL........ 328
63 -11.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  15  110....................TRTIDRIESFFGELGFTVATGPEIEDD-----NFDALNIPGHHPARADHDTFWFDTTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNIS--FTNLKGTLHDFLRNFFEEDLQIR-----------------------------------------FRPSYFPFTEPSAEVDVMGKNGKW--------------------LEVLGCGM-----------------------------------VHPNVLRNVGIDPEVYSGFGMGMERLTMLRYGVTDLRSFF....... 316
64 -10.6003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  13  49................FFMENAIMRLCEEEYAKVGISQILFPTVIPESFESDHIKGFEAECKGGLQPLEERLALRPTSETAIYSMFSKWVRKIHQTCTIFRHETKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAPPLIAPIIPIGCGKKNNQESDQ------QVLGKVNEIADTLKSKLGLRVSIDDDFS-----KSMGDKLYYYELKGVP------------LRIEVGQRDLAN......... 369
65 -10.5006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  13  214..............DLVRMNLALQNYAIDFLAKKGYMPIYTPFMTKEQMKKVAQLSQFDEELYTVTGEGEDKYLIATSEQPIAAFHLEKR-KYCGMSTCFRKEGIFRVH--QFEKIEQFKSWEMFDEMIGNSEAFYQSL----------------------------------------------------------------------PYRVVNIVSGALNNAAAKKFD------LEAWFPGADEGNEYRELVSCSNQTRRLEVKYGKSKKQGSEV-----EFCHMLN-------STLTATSRTLCCIVENYQTPEGVNVP.... 462
66 -10.4002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  61................HRVLKKIEQIVREEQNRAGAIELLMPTLQLA-RESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKNLYHIQWKFRDERFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNT-----RGIEVGQIFY---------TKYSD-------------SMKANVTGPDGTDAPIHGGYGVGVSRLLGAIIEACHDDNGIIWPEAVA 358
67 -9.8204p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  15  110....................TRTLERIEQCFSRIGYEVAEGPEVEDD-----NFEALNIPGHHPARAMHDTFYFRTHTSPVQVRTMESQQPRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVS--FADLKGTIEEFLRAFFEKQLEVR-----------------------------------------FRPSFFPFTEPSAEVD--IQCVICSGNGCRVCKQTG--------LEVMGCGM-----------------------------------VHPNVLRMSNIDPEKFQGFGMGAERLAMLRYGVNDLRLF........ 326
68 -9.5901nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  11  38................FKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKKIYQIVNTFRYETKHTRPLREIMTFEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLIS-KRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASI----PPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYE-KLKGKFRVHIDDRDIRPGRKFNDWEIKGVP------------LRIEVGPKDIEN......... 350
69 -9.5604k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  11  71................YAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKT-VAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQKLNQWCNVVRWEPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYR---------------RRLLSVNIRVRADLRDNYSPGWKFNHWELKGVP------------IRLEVGPRDMKS......... 393
70 -9.4803lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  11  206..............GLVQLQVALVSYSLDFLVKRGYTPFYPPFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRW-KYAGMSTCFRKEGIFRVH--QFDKIEQFESWRHLEDMITTSEEFNKSL----------------------------------------------------------------------PYRVVNICSGALNNAAAKKYD------LEAWFPAS---GAFRELVSCSNQSQSV--NCRYGPNLRGTAAQNVKEYCHMLN-------GTLCAITRTMCCICENYQTEEGVVIP.... 454
71 -9.4504hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  55................YAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSA-ADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQKLNQWCNVVRWEPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNTRTIGVMTMVHGDNPPRVACVQVVI--IPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLKFNHWELKGVP------------IRLEVGPRDMKS......... 377
72 -9.4201h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  13  44................YAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFEAEHVEGFSPELAAGGEELEEPLAVRPTSETVIGYMWSKWIRLLNQWGNVVRWE-RPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSIGAIIMTHGDDPPRLAPIQVVIVPIYKDESRERVLEAAQGRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVP------------FRVELGPKDLEG......... 357
73 -9.1201usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  4..................LDFEKVFSFYSKATKKGFSPFFVPALEKA----------EPAGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPKVWYADFVYRYSGSDLV--------AEYQLGL----------EKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHT--------------------GVYEDLLKEIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSRSPEHLKTMDLPLSVREDLLSASS--FLQEKFPTVSVEIDLTLARTIEE-GEKGVGGSIFLEGKT.................... 274
74 -9.0801nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  13  66.....................MIRKNTLKILRRRDHEEVLFPLLVPEDEEAIHVKGFEDEVHGGLSKLQRKLALRPTSETVMYPMFALWVRRFYQVVNTFRYETKHTRPREITTFKEAHTIHATASEAEEQVEEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETP-----GDHEYVHQTCYGLSIASVIAIHGDEPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVP------------LRVEIGPRDLEK......... 377
75 -9.0705xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  10  43................YRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKEKDHVEGFKPEVAYGDSELPEKVAIRPTSETIMYPAYAKWIRKLNQWNNVVRWE-TPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTLGVMIMTHGDDPPRVVAVQAVIIPIIFKETGGMVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVP------------LRLEIGPRDVES......... 359

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.