current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3i7f_A mol:protein length:548 Aspartyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .
# Score Template Links and tools%idFirst GPGSMAATQEKKPQLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVDEKIAKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNPLast
1 -152.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model  100  1GPGSMAATQEKKPQLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVDEKIAKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
2 -133.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  47  3SSSSGLVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEA-------------------------------------------EGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
3 -125.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  51  1........................EDTAKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKEISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAE-------------------------------------------AAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
4 -119.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  34  1..............................................MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKV-DPELFKLIPKLRSEDVVAVEGVVNFTPK-----AKLGFEILPEKIVVLNRAETPLPLDPTGKVK-------------------------------------------------------AELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELE---EPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
5 -114.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  24  3...............SSSSGLVPRGSHMAKKITIKNDPSLPEPKCVKIGAL------EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQCYN----GVLLSTESSVAVYGMLNLTPK--GKQAPGGHELSCDFWELIGLAPAGGADNLINEE--------------------------------------------------------SDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCL-PALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFL-TFDDLLNRLEDLVCDVVDRILKSPAGSIVHELN--PNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 466
6 -114.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  26  1................................GPGSMMTEATTTPVETPIVCNIRDAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCEPEK---VKLLTRECSLEITGRLNAYAGKNEIADILNLEMQVTEWKVIGESPIDLE---------------------------------------------------------NIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVI-ASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFI-SFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPH---LKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
7 -113.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  35  1..............................................MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKN----SSAFGISQELTQESVIQVRGIVKADKR-----APRGIELHAEEITLLSKAKAPLPLDVSGKVK-------------------------------------------------------ADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFA-DYNDVMQLLEKILHNIVKTIKEEGKEELKILNYE---PPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPEL----RILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
8 -111.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  31  1..............................................MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVV-GEETFEKAKKLGRESSVIVEGIVKADER-----APGGAEVHVEKLEVIQAVSEFPI---------------------------------------------------------PENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWM-DLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEER-----VLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
9 -110.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  27  1................................................TGVKIRDL-VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQTYD----ALTVNTECTVEIYGAIKEVPE--GKEAPNGHELIADFWKIIGNAPPG--------------------------------------------------------GIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPT-LGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFI-TLDDLMEKIEELVCDTVDRLLADEEAKKLLEHIN-PKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
10 -110.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  34  2.................................................RVLVRDL-KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL-----------KLPLPESALRVRGLVVENAK-----APGGLEVQAKEVEVLSPALEPTPVEI------------------------------------------------------PKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMV-GVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIADEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWP---SFPQDIPRLTHAEAKRILKEELGY-PVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
11 -90.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  59TTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQ--QPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKK-------GELSIIPYEITLLSPCLHMLP---------------------------------------------------------HLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYA-DYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQYDVDFTPPFRRINMVEELEICVAKAVECPPPRTTA-RLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQGDDEAMDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
12 -87.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  20  2......................................................................................................................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESKDDGRHAYEFTQLDFEVERA-KMEDIMRLIERLVYGLFRKAEEWTGREFPKTK-----------RFEVFEYSEVLEEFGS--------------------DEKASQEMEEPFWIINIPREFYDREVDGFWRN----YDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPA. 292
13 -87.6005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  1.MAMGTLEAQTQGPGSHYTDNRYKMMECIKDAGRPFYPHKFKISMSLPAYAL-VENGYIDKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMDISTGEFSVSHSEIRRGDVVGFTGFPGKSKR-------GELSLFSKSVVLLSPCYHMLP---------------------------------------------------------TAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHLETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDL-THNPEFTAMEFYMAYA-DYYDLMDLTEELISGLVLEIHGSLKIPYHPDGPEGKIEIDFTTPWKRFSFVEEIEMCEKHEIELPHPRTAA-KLLDKLAGHFVETKCTNPSFIIDHPQTMSPL-AKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNV... 516
14 -87.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  2..EQETRGANEAIDFNDELRNRREKLAALRQQG-VAFPNDFRRDHTSDQLHEKDNQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQT-------GELSIHCTELRLLTKALRPLP---------------------------------------------------------DKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYA-DYHDLIELTESLFRTLAQEVLGTTKVTYG------EHVFDFGKPFEKLTMREAIKLAESIGITVEKSWGLG-RIVTEIFDEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQGDDEAMDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQ... 503
15 -87.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  21  2......................................................................................................................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESKDDGRHSYEFTQLDFEIEGA-KMKDVMRLIEELIYGLFRKAEEWTGREFPRA-----------RHFKVYDYKDILEEFGS--------------------DEKASMEMEEPFWIVNIPREFYDREE----NGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAV 293
16 -87.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  2..EQHAQGADAVVDLNNELKTRREKLANLREQG-IAFPNDFRRDHTSDQLHAKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKT-------GELSIHCTELRLLTKALRPLP---------------------------------------------------------DKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYA-DYKDLIELTESLFRTLAQDILGKTEVTYG------DVTLDFGKPFEKLTMREAIKIAESIGIHVEKSWGLG-RIVTEIFEEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQGDDEAMDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 503
17 -87.2004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  16MTEPIQPQAAVAADENQIVAERRDKLRALRDQG-IAYPNDFQPTHHAADLQTADKEALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADV-GAETYDAFKKWDLGDIVAARGVLFRTNK-------GELSVKCTQLRLLAKALRPLP---------------------------------------------------------DKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYT-DYRWLMDFTERLIRQAAVDALGTATIQYQ------GRELDLAQPFHRLTITQAIQELKRLGVDVTQPAFLNGALQLALFEETAEAQLWEPTFIIDYPIEVSPL-ARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQGDEEAMDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRE... 522
18 -86.4005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  2.........ADPSDPQEYFKLRTALINERRSKGINPYPHKFHVSISLADFIA--EKDVILNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHGDEAFDNLHDRIKRGDIIGVNGYPARSKS-------GELSIIPYEIIQLTPCLHMLP---------------------------------------------------------HTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQ-THNPEFTSCEFYMAYA-DYEDLMKITEDMLARMVYYMHGTYKIQYHGIVENPVYEVDFTPPFRKVNIYDGLQLAVENNVECPAPRTTA-RLLDKLIGEFLEPTFISPTFLTGHPQIMSPL-AKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQGDDEAQDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPD... 511
19 -86.1003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  20  1..........SHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFELSKEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDV-GEQQYELFKISDLGDIVGVRGTMFKTKV-------GELSIKVSSYEFLTKALRPLP---------------------------------------------------------EKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYA-DFRDIMKLTENLIAHIATEVLGTTKIQYG------EHLVDLTPEWRRLHMVDAIKLAKEHGVEVAPHMTFG-HIVNEFFEQKVEDKLIQPTFIYGHPVEISPL-AKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQGNDEAHDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
20 -86.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  2...........EVDPRLYFENRSKFIQDQKDKGINPYPHKFERTISIPEFIE-LGNGEHLEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHENFAECYDKIRRGDIVGIVGFPGKSKK-------GELSIFPKETILLSACLHMLP----------------------------------------------------------MKYGLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDN-THNPEFTSCEFYWAYA-DYNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPENQIEIDFTPPYPKVSIVEEIEIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFFIVEHPQIMSPL-AKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPA... 507
21 -85.8005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  19  2......AMSSAESNIPEQFRIRRDKRARLLAEGYDPYPVAIERTHTLAEIRATYA-TDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRR-------GELSVLADSWRMAAKALRPLPVAHKE----------------------------------------------------------MSEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSLDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDS-THSPEFSMLETYQTYG-TYDDSALITRELIQEVADEAIGTRQ-----LSMPDGSVYDIDGEWATMEMYSSLSIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPL-TRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQGDDEAMDEDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETVLFPIVRPH... 498
22 -85.8006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  20  2...AMTPPESVDPDLPEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEIRQAYP-VDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKR-------GELSVLADSWQMAAKALRPLPVAHKE----------------------------------------------------------MSEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSLDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADS-THSPEFVMLETYQAYG-TYDDSAVVTRELIQEVADEAIGTRQ-----VPLPDGTVYDLDGEWESIQMYPSLSIADRLGLDIPRDRGYGGKLVEELWEHTVGAKLWAPTFVKDFPVETTPL-TRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQGDDEAMDEDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETVLFPIVKPR... 502
23 -85.7003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  2...........SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQ--QPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEFIHINNKLRRGDIIGVQGNPGKTKK-------GELSIIPYEITLLSPCLHMLP---------------------------------------------------------HLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYA-DYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQYDVDFTPPFRRINMVEELEICVAKAVECPPPRTTA-RLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAADENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 508
24 -85.6004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  15  2............MLSKQLFLNRCKDVEEYQKAGHNPWPHKFNVSITVPEFIA-GLEKSQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYENKE------DFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLP---------------------------------------------------------SMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQT-HNPEFTTCEFYMAYA-DYNDIMKMTEELLGNMVKDITGG-----STKLEIKDRLMDINNEEDIKMLEKFFKKMVLDFTAPFKRISYVHALEEKFGEKIPEVDLVQPTFVCDQPQLMSPL-AKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPE... 564
25 -83.7001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  1..............................................MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATA----ERVRPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEK--------------------------------------------------EASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFV-EVEDVLELNERLMAHVFREALGV----------------ELPLPFPRLSYEEAMELLFVAGPRKVAATALGAVRLREWDEEEEAWTYMHHPFTSPHPEDLPLL---EKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDP 557
26 -81.8004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  4...............................................MRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPD---RAETFAKADRVRSEFVVKITGKVRLRPEGAPNMASGSIEVLGYELEVLNQAE--------------------------------------------------------TPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFL-DESDIIGITEKMVRQLFKEVLDV-----------------EFDEFPHMPFEEAMRVFFGADKAKIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPMFLSALHELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDV 566
27 -79.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  18  1...............................................MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPD---RADALKLASELRNEFCIQVTGTVRARDEKNRDMATGEIEVLASSLTIINRA----------------------------------------------------------DVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFLPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFM-TAPQVREVMEALVRHLWLEVKGV-----------------DLGDFPVMTFAEAERVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAA-ELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACL 563
28 -79.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  19  2........................AMGTLEAQTQGPGSMV-------LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA-----AHRLRAEFCVAVTGVVEVRPEGNPEIPTGQIEVNATELTVLGESA----------------------------------------------------------PLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFV-EADDVIAISEQVLKAVWATIGYD-----------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGG-AP 584
29 -78.8005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  2...........................GSSSSGLVPRGSHVFVLRS----HAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ--DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNPEIATGEIEVNATSLTVLGECA----------------------------------------------------------PLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFLPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFV-DAEDIIAISEEVLTELWALIGYR-----------------IPTPIPRIGYAEAMRRFGTDKPDLRFGLELVERVEIANRLGLIDPDAWAFVWVVDPPAVHHAF-RIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG.... 578
30 -78.8004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  1..............................................MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA-----AHRLRAEFCVAVTGVVRPEGNENPEIPTGQIEVNATELTVLGESA----------------------------------------------------------PLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFV-EADDVIAISEQVLKAVWATIGYD-----------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDP 563
31 -76.3004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  2.................................IPEFSSFVVRTNT------CGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDES-AASVKKILCEAPVESVVQVSGTVISRPAGQPKMPTGEIEIKVKTAELLNACKK--------------------------------------------------------LPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGG-AKEFLVPS-GKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFV-DQTGIQSLIEGLLQYSWPNDKDP-----------------VVVPFPTMTFAEVLATYGTDKPDTRFGMKI-ADLLETRGVVLRDPTLFSFLWVVDFPSAHHPF-LLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDL 574
32 -63.2003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  15  1..........................................................................................................................................................................................................................MGSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLVPFETRFQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHY-DMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGK---EKPTFVYHFPASQASL-AQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAADQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA.... 339
33 -62.3003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  16  9...........................................................................................................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLFPFETRFQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHY-DMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEI------DPLSADKTQLREAAAKLDLSNIADTEEDDTLLQLLFTMGVEPHIEKPTFIYHFPASQASL-AQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAADQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA.... 326
34 -62.1004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  3....................................................................................................................................................................................................................................DDGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDEKAVQVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMK-DDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILAEHLLLAYPNLTAKEREREIREYGAVFLIGIGAVLSSGDRHDARAPDYDSPVEASQVVFPRTSKPIPTMNSLSNGDILLYNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWPEEIRKKHN 349
35 -60.60011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  3........................................................................................................................................................................................................................................TAYI-AKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLHSVYVDQWDWERVMG-DGERQFSTLKSTVEAIWAGIKATEAAVSEEF----GLAPFLPDQIHFVHSQELLSRYPDLDAKGREAKDLGAVFLVGIGGKLSDGHDVRAPDYDDWSTPSELGHAGLNGD---ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP 327
36 -30.3004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  18  1...........................................AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERKTPDHLFKVFAELSREDVVVIKGIVEASEQ---YGSATGVEIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................................................... 108
37 -30.0004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  18  4...............................................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERKTPDHLFKVFAELSREDVVVIKGIVEATTV---TRWDTGVEIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................................................... 107
38 -29.9004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  17  8...............................................KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYKTPDHLFKVFAELSREDVVVIKGIVEASKA--AADMHNGVEIFPSEIWILNKAK.......................................................................................................................................................................................................................................................................................................................................................................................................... 113
39 -29.7004gla_C mol:protein length:109 OBody NL8  ali model follow..  18  6...............................................KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYEAGKTPDHLFKVFAELSREDVVVIKGIVEASK-----GVGRGVEIFPSEIWILNKAKA......................................................................................................................................................................................................................................................................................................................................................................................................... 109
40 -29.3004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  4...............................................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERKTPDHLFKVFAELSREDVVVIKGIVEAGWP---VALDTGVEIFPSEIWILNKAKP......................................................................................................................................................................................................................................................................................................................................................................................................... 109
41 -28.9005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  6...............................................MRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS----SKAYEKALEVRSEFVLVAKGKVRLRGAGLPKLKTGKIEIVLEELIIENKS........................................................................................................................................................................................................................................................................................................................................................................................................... 109
42 -27.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  3..........................................................................................................SSSSGLVPRGSHMFLTRRDPPLSTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIE---------------------------------------------------------HQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKSTIGEDHPLFSQVFDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGA-QHLNEFTMLNLTELG-TPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDP----ERLLMIREGTQHVQSMARSLSYLDGVR......................................................................................................... 298
43 -23.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  10....................................................................................................................................................................................PRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYA--EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK-EHLEEFTMLSFIQMGSGTRENLESIITDFLNHLGID------------------------------------------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGID---------------KPWIGAGFGLERLLKVKHDFKNIKRA............ 271
44 -22.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  10....................................................................................................................................................................................PRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYA--EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGTRENLESIITDFLNHL------------------------------------GID------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGIDK---------------PWIGAGFGLERLLKVKHDFKNIKRA............ 271
45 -22.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  19  51................................................................................................................................................................................................................................................EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLRKLDRALPDPIKIFEIGPCYRKESDGKE-HLEEFTMLAFAQMGSGTRENLESIITDFLNHL---------------------------------------------------------------------------------------FKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 254
46 -22.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  3..........................................................................................................................................................................SSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----YAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDG-KEHLEEFTMLNFCQM---GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDR------------------------EWGIDKPWIGAGFGLERLLK-VKHDFKNIKRAARSESYYNGIST............................................................................ 283
47 -21.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  17................................................................................................................................................................................................................PKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKE-HLEEFTMLNFFQMGSGTRENLESIITDFLNHL---------------------------------------------------------------------------------------FKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 253
48 -17.8003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  15..............................................................................................................................................................................................APALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNY----KIFEIGPCYRKESDG-KEHLEEFTMLVFWQMGSGCRENLESIITDFLNHL--------------------------------------------GID----------------------------------------FKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLD------REWGIDK---------------PWIGAGFGLERLLKVKHDFKNIKRA............ 268
49 -16.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  51................................................................................................................................................................................................................................................EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEIDNDTELSKIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDG-KEHLEEFTMLNFCQMGSGCRENLESIITDFLNHL--------------------------------------------GID----------------------------------------FKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 254
50 -14.6002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  10  50.......................................................................................................................................................................................................................................................TRTVEEIEDLFLGLGYEIVDGYEVEQDKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDAT-HSHQFTQIELVVDKNIKMSDLKGTLELVAKKLFGA--------------------------REIRLRPSYFPFTEPSVEVD------------------------------SCFKCKGKGCNVCKHTGWI-----------EILGAGM------VHPNVLEMAGFDSNEYSGF------------AFGMGPDRIAMLKYGIEDIRYF............ 269
51 -13.2001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  17  19...........................................QGPNGSVTTVESAKSLRDDTWVTLRGNI--VERISDDLYV-FKDASGTINVDIDHKRWNGVT-------VTPKDTVEIQGEVDK--------DWNSVEIDVKQIRKVNP............................................................................................................................................................................................................................................................................................................................................................................................................ 109
52 -12.8003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37...................................................................................................................................................................................................................................................MRCRRHLFDVFHATAKTFGFEEYDAPVLESEELEITEQMFNFTKGGHRVALRPEMTPSLARLLLGK--KWYSIPQCWRYEAITRGRR-REHYQWNMDIVGVKSVSELVCAACWAMRSL-RKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDDASVVRGLAYYTG-RALCGGGR----YDNLLTTYGSPT-----------------IPCAGFGFGDCVIVELLQEKRLLPDI............ 352
53 -12.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  37...................................................................................................................................................................................................................................................MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELEITEQMFNFTKGGHRVALRPEMTPSLARQLLAK--KWYSIPQCWRYEAITRGRR-REHYQWNMDIIGVKSVSELVCAACTAMQSL-RKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDDASVVRGLAYYTG-RALCGGGR----YDNLLTTYGSPT----------------AVPCVGFGFGDCVIVELLNEKKLLPE............. 351
54 -12.5001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  104.......................................................................................................................................................................................................................................................TLMERELVEIFRALGYQAVEGPEVESEPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSRIVVPGRVFRFEQTDAT-HEAVFHQLELVVGEGIAMAHLKGAIYELAQAL---------------------------------------------------------------------------FGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMKVFQAVDAYRERLGLPPAYRGVTGF------------AFGLGVERLAMLRYGIPDIRYF............ 335
55 -12.4003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  15............................................EASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVI-----EAELRSTKHWELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLLKVRSQFRQIFLEMGFTEMPTDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQKYFSIDRVFRNETLDAT-HLAEFHQIE---GVVADHGLTLGHLMGVLREFFTKLGIT-------------------------------------------------------------------------QLRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGV------FRPEMLLPMGLPEN-----------------AWGLSLERPTMIKYGINNIREQMVYDSPLCRLDA 497
56 -12.2004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  81...................................................................................................................................................................................................................................................MAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRRYREFYQCDFDIAGNFD--ECLKIMCEILSSL-RRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVAD--HGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTL-DLSLARGLDYYTG-GSVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 404
57 -12.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  4.............................................................................................................................................................................................................................MAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLENQGDNIIYGLDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRF-RQFRQCDIDVVGREKLSQMPAIITEIFEAV-RKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQK------------------------------IIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFNYYTGTVRYEKMPGVGISIGLTRLISRLLKAGILNTL............ 367
58 -11.9004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  4...........................................................................................................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRRYREFYQCDFDIAGNFD--ECLKIMCEILSSL-RRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVAD--HGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTL-DLSLARGLDYYTG-GSVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 351
59 -11.7003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  110.......................................................................................................................................................................................................................................................TRTIDRIESFFGELGFTVATGPEIEDDGHHPARADHDTFWFDTTRLLRTTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQT-HTPMFHQMELIVDTNISFTNLKGTLHDFLRNFFEE--------------------------LQIRFRPSY-----------------------------------------FP------FTEPSAEVDVMGKNGKWL----EVLGCGM---------NVLRNVGIDPEVYSGF------------AFGMGMERLTMLRYGVTDLRSF............ 315
60 -11.5004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  13  110.......................................................................................................................................................................................................................................................TRTLERIEQCFSRIGYEVAEGPEVEDDGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPRIVCPGRVYRCDSDLT--HSPMFHQVEGLLVDEGSFADLKGTIEEFLRAFFKQLEVRFRPSF---------------PFTEPSAEVDIQCVICSGNGCRVCKQTG------------------------------------------------------EVMGCGM------VHPNVLRMSNIDPEKFQGF------------AFGMGAERLAMLRYGVNDLRLF............ 326
61 -11.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  1............................................................................................................................................................................................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYLTLRPENVVRAAIEHNMLRLWYIGPMFRHERPQRGRY-RQFHQVGVEALGFAG--EIVMMCQRLWEDL----LTGIKLEINSLGLAEE----------RAAHRVELIKYLEQHAD-KLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLK-LVRGLDYYNLTV----FEWVTDKLGAQGT--GRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE............. 345
62 -11.4002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  16  26...................................................................................................................................................................................................................................................TAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYLTLRPEGCVRAGIEHGLLRLWYIGPMFRHERPQKGRY-RQFHQLGCEVFGLQG--ELIMLTARWWRAL--GISEHVTLELNSIGSLEA----------RANYRDALVAFLEQHKE-KLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLE-LVRGLDYYNRTV----FEWVTNSLGSQGT--GRYDGLVEQLGGRATPAVGFAMGLERLVLLV..................... 323
63 -11.4001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  10  2.................................................................................................................................................................................................................................YRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLELLQQTYSFDKGGREVTLIPEATPSTVRMVTSR--RWYSFPKVWRYEEPQAGRY-REHYQFNADIFGSDSPEEVIALASSILDRL--GLQDIYEIRINSRKIMEEIIGGMTSS-DPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARIRMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVEAYDRSGQFRAILGGG----RYDNLASLMSGESVPAVGFGMGDAVISLLL..................... 321
64 -11.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  30...................................................................................................................................................................................................................................................VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFITLRYDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRS-TENYQIGIEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISS---DQLKEFSEKLSMIKPIIIDLGMVPKMDYYT-----------MFKAYSSAQPILSGGR----YDQLLSNF-------------------EEAFAIGFCCHMDTILKAL..................... 328
65 -11.3001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  12  4.....................................................................................................................................................................................................................................................LDFEKVFSFYSKATKKGFSPFFVPALEKAEEDRKGNLFSIREDFTKTVLNHRKRYSPDSQI-----KVWYADFVYRYSGSDLV----AEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTG-PKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDL----PLSVREDLLSASSFLQEKFPTVSVEIDLLARTIEEYCGLIFTIYDTSSSRLVAAGG-------------EYTGEKGVGGSIFLEGKT........................ 274
66 -11.1005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  20...................................................................................................................................................................................................................................................TAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYLTLRPEGCVRALVEHNLLRVWYMGPMFRYEKPQKGRY-RQFHQFGVETFGVAT--ELIMLTARLWKRM--GVDHMVQLELNTLGETDERTEYRNALVAFLEHKDALDEDSQRRLTTNPLRILDSKIESKLHDFLKEDSLSHFQQLQDYLTAAGIKFVI----NQKLVRGLDYYNK-GTVCAGG----RYDGLVGQLKGKADQS--------------VPAVGFAMGMERLLLLL..................... 322
67 -11.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  10  30............................................................................................................................................................................................................................................QDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEARSPESSRDWIRLDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLKAAESTQVGIERIGEEA--DVLRLLHEASAAA-ARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLAN------------------------LLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDELDYYTGLVQFGAGPAVGFAFEVERVMAVLEAQEEGEGEC........... 373
68 -10.9004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  12  2..................................................................................................................................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFLTLRPEGMVRAYLEHGMKRLWMAGPMFRAERPQKGRY-RQFHQVNYEALGSEN--EAVVLLYECLKELVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQA---LKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYEL----EPALVRGLDYYVR-SALGGGGR---------------------YDGLSELLGGPRVPGVGFAFGVERVALAL..................... 318
69 -10.8006FTT Entity 1(prereleased)  ali follow..  10  15...................................................................................................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEITIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYT-----NLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGY-----HYHT-----------VFNGYINSQPLVRGGR----FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
70 -10.8005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  15...................................................................................................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEITIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYT-----NLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGY-----HYHT-----------VFNGYINSQPLVRGGR----FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
71 -10.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  24...................................................................................................................................................................................................................................................YKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVQLFKLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKP-AEFEQLGVELIGDGTASEVIALMIAALKRA----VGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLGRAAIEEARGLIQTEKGKTAL------AEMTKLYEVLESYGASEYVKFDLLVLHMSYYTGVVFEGYGNRLGVPLCSGG--------YDELLSFHRPQATGFGVRIDLLVEAL..................... 327
72 -10.7001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  14  16...................................................................................................................................................................................................................................................SKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYITLRPEGVVRSYIEHKM-KLYYNGPMFRYERKQKGRY-RQFNQFGVEAIGAEN--EVLAMVMHIYQSFVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYT---------DPNLVRGLDYYTH-TTLCGGGR---------------------YNGLLELLDGPSETGIGFALSIERLLLAL..................... 317
73 -10.6005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  13  133.......................................................................................................................................................................................................................................................GIDIDEEKKERLREVLHLYKKGAIDGVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSG--KLFSIDRCFRREQREDRSHLMSYHSASCVVVGEDSVDDGKVVAEGLLAQF---------------------------------------------------------------------------GFTKFKFKPDEKKSKYYTPETQTEVYAYHPKLGEEVATFGV---------IALAKYNIDVPVM---------------NLGLGVERLAMIIYGYEDVRAMV........... 355
74 -10.5003kf6_A mol:protein length:159 Protein stn1  ali model follow..  10  48..............................................................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKR-AISMSPGNVVCVFGKINSFR--------SEVELIAQSFEELRDPNDEW....................................................................................................................................................................................................................................................................................................................................................................................................... 133
75 -9.7102du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  118...................................................................................................................................................................................................................................................ITKREVDSKPLQEIFHRYKKGEIDGDDLLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTG--KLFSIDRCFRREQGEDATRLYTYFSASCVLVDEESVDDGKAVAEALLRQF---------------------------------------------------------------------------GFENFRFRKDEKR-------------SKYYIPDTQT----------EVFAFHPKLVGSSTKYSDGWIEIATFGI-PT-NLGLGVERLAMILYGYDDVRKMV........... 347

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.