current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETPLAAYAEDDRLGIWICGQRVHNSWAHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALMLast
1 -99.9003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model  100  1SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETPLAAYAEDDRLGIWICGQRVHNSWAHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM 213
2 -99.1003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  52  1SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLNCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKVLAPYSEDYHLGLWVTGKMVSNSWAHADENTSVYELKAYVENIFKRLGLDLHSLVVGNLSDDIYSTALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM 213
3 -59.0003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  388ANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPL-PLKLFEISDIVIKDSNTDV------GAKNYRHLCAVYYN-----------KNPGFEIIHGLLDRIMQLLDVPPGEDIKASEGPAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL 589
4 -58.6003pco_B mol:protein length:795 Phenylalanyl-tRNA synthetase, beta chain  ali model follow..  23  486GTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIH--PGVEALLLPSPISVEMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAP------LGIRQDLMLAGVICGNRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKLA 690
5 -56.5004p71_A mol:protein length:792 Phenylalanine--tRNA ligase beta subunit  ali model follow..  27  486NNKPEARAALPLLRRLLVARGYQEAITFSFIDPALFELFD--PGTQPLTLANPISADMAAMRSSLWPGLVKALQHNLNRQQSRVRLFESGLRFVGQLEG---------LKQEAMLAGAICGKRLPEGWANGRDGVDFFDAKADVEAVLASAGALGDFSFVPGEHPALHPGQTARIEREGRLVGYLGALHPELAKKLDLEQPVFLFELLLAEVV 687
6 -52.4002rhs_B mol:protein length:800 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  22  494GELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFAL-QERPTISLLMPMSEAHATLRQSLLPHLIEATAYNVARKNKDVRLYEIGRVFFGNGEGE-------LPDEVEYLSGILTGEYVVNAWQGKKEEIDFFIAKGVVDRVAEKLNLEFS--YKAGKIEGLHPGRTAIVSLGGAGIGFIGELHPQVAADNDLK-RTYVFELNYDAMM 695
7 -46.9001b70_B mol:protein length:785 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  24  486RGVEAPYRKEQRLREVLSGLGFQEVYTYSFMDPEDARRFRL--DPPRLLLLNPLAPEKAALRTHLFPGLVRVLKENLDLDRPEALLFEVGRVFRER--------------EETHLAGLLFGEGVGLPW-AKERLSGYFLLKGYLEALFARLGLAFR--VEAQAFPFLHPGVSGRVLVEGEEVGFLGALHPEIAQELELP-PVHLFELRLPLPD 679
8 -31.6003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  45QQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTT-DSLLIPADHPSKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRVDCYFPFTHPSFEMEINFHGEEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLA 284
9 -28.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  58.......KLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLNFFQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCS------GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 241
10 -27.6005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  17  52ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLAFAQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 242
11 -26.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  72...NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLSFIQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCM------GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 259
12 -25.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  74.....LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLNFCQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCM------GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 259
13 -25.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  71.....LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLVFWQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCM------GDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERL. 255
14 -23.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  75......GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLNFCQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCM------GDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERL. 258
15 -23.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  58......GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLNFCQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCM------GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 242
16 -21.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  88......LELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKK-CLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQH------LNEFTMLNLTELGTPLEER-----------RLEDMARWVLEAAGIREFELVTESSV-----GDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLL 275
17 -14.6003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  10  35DFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPASLSWASGKAAESTQVGIERIGE-------EASVDVDM-DVLRLLHEASAAAGVRHHRIVVSH................................................... 188
18 -13.4005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  14  127EIIKNLGIDIDEEKKERLREVLHLYIDGDDLVFEIAKALNVSNEMGLKVLETAFESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLM-----SYHSASCVVVG-----------EDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKSKYYTPETQTEVYAYHPEVATFGVYSPIALAKYNIDVPVMNLGLGVERLA 342
19 -12.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  22EWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQ-QGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEG------GKPAEFEQLGVELIGDGTASA----------GEVIALMIAALKRAGLSEFKVAIGH................................................... 167
20 -11.8003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  222GHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFFDALFQPQQHPARDQHDTFEARKNLLRTHTTSASARALRLAQKKPFTPVKYFSIDRVFRNETLDATHLA------EFHQIEGVVAD-----------HGLTLGHLMGVLREFFTKLGITQLRF-KPAYNPYTEPSMEVFSYHQGLEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPT 465
21 -11.5002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  21  178.......................................................SSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFR--REQGEDATRLYTYFSASCVLV--------------DEELSVDDGKAVAEALLRQFGFENFRFRKDEKRKYYIPDTQTEVFAGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLA 334
22 -11.1006FTT Entity 1(prereleased)  ali follow..  12  13EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHH--GGDGIARYCYAGDVIHTLPSGLFGS------RTPLQLGAEIFGCESIAA----------IELIDVLFSMINSLDMSA.......................................................... 151
23 -11.1005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  13EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHH--GGDGIARYCYAGDVIHTLPSGLFGS------RTPLQLGAEIFGCESIAA----------IELIDVLFSMINSLDMSA.......................................................... 151
24 -11.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  98GGLHPITLMERELVEIFRALGYQESEFFNFDALNIPEHHPARDMWDTFWLTGE-VEGRLLLRTHTSPMQVRYMV----AHTPPFRIVVPGRVFR---FEQTDATHEAVFHQLEGLVV--------------GEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYPFVEPGAQFAVWWPEGELGGAGMVHPKVFQAVDAYRERFAFGLGVERLA 323
25 -10.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  35ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITR------GRRREHYQWNMDIIGVKSVSS----------VELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEK................... 213
26 -10.6002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  44GSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYFEALNLPKSHPARDMQDSF-TDEILMRTHTSPVQARTME--KRNGQGPVKIICPGKVYR---RDSDDATHSHQFTQIEGLVV--------------DKNIKMSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIA 257
27 -10.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  35EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITR------GRRREHYQWNMDIVGVKSVSA----------VELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQA---GVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGL. 228
28 -9.4201z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  28NQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQI--KDSTSARYSYFGKIFRKEKRHK------GRSTENYQIGIELFGESADKS----------LEILSLALQVIEQLGLNKTVFEIGS................................................... 175
29 -9.0201usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  10  5.....DFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDR----------KGNLFSIREDFTKTVLNHRKRY--SPDSQIKVWYADFVYRYSGSD---------LVAEYQLGLEKVPRNSLDD----------LEVLEIIVESASEFFEGPVIVEIGH................................................... 131
30 -9.0103pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  104GGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPAR---ADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVY---RNDYDQTHTPMFHQMEGLIV--------------DTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYPFTEPSAEVDVMGKNGEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLT 303

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.