current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLNCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKVLAPYSEDYHLGLWVTGKMVSNSWAHADENTSVYELKAYVENIFKRLGLDLHSLVVGNLSDDIYSTALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELMLast
1 -101.0003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model  100  1SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLNCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKVLAPYSEDYHLGLWVTGKMVSNSWAHADENTSVYELKAYVENIFKRLGLDLHSLVVGNLSDDIYSTALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM 213
2 -99.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  52  1SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETPLAAYAEDDRLGIWICGQRVHNSWAHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM 213
3 -58.9003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  18  388ANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPL-PLKLFEISDIVIKDSNTD------VGAKNYRHLCAVYYN-----------KNPGFEIIHGLLDRIMQLLDVPPGEDIKASEGPAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL 589
4 -58.8003pco_B mol:protein length:795 Phenylalanyl-tRNA synthetase, beta chain  ali model follow..  20  486GTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIH--PGVEALLLPSPISVEMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAP------LGIRQDLMLAGVICGNRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKLA 690
5 -56.6004p71_A mol:protein length:792 Phenylalanine--tRNA ligase beta subunit  ali model follow..  22  486NNKPEARAALPLLRRLLVARGYQEAITFSFIDPALFELFD--PGTQPLTLANPISADMAAMRSSLWPGLVKALQHNLNRQQSRVRLFESGLRFVGQLEG---------LKQEAMLAGAICGKRLPEGWANGRDGVDFFDAKADVEAVLASAGALGDFSFVPGEHPALHPGQTARIEREGRLVGYLGALHPELAKKLDLEQPVFLFELLLAEVV 687
6 -52.7002rhs_B mol:protein length:800 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  22  494GELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFAL-QERPTISLLMPMSEAHATLRQSLLPHLIEATAYNVARKNKDVRLYEIGRVFFGNGEGE-------LPDEVEYLSGILTGEYVVNAWQGKKEEIDFFIAKGVVDRVAEKLNLEFS--YKAGKIEGLHPGRTAIVSLGGAGIGFIGELHPQVAADNDLK-RTYVFELNYDAMM 695
7 -47.0001b70_B mol:protein length:785 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  20  486RGVEAPYRKEQRLREVLSGLGFQEVYTYSFMDPEDARRFRL--DPPRLLLLNPLAPEKAALRTHLFPGLVRVLKENLDLDRPEALLFEVGRVFRER--------------EETHLAGLLFGEGVGLPW-AKERLSGYFLLKGYLEALFARLGLAFR--VEAQAFPFLHPGVSGRVLVEGEEVGFLGALHPEIAQELELP-PVHLFELRLPLPD 679
8 -31.8003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  45QQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTT-DSLLIPADHPSKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIWVDCYFPFTHPSFEMEINFHGEEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLA 284
9 -28.5004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  58.......KLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLNFFQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCSV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 241
10 -27.9005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  17  52ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLAFAQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 242
11 -27.3004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  69ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLSFIQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 259
12 -25.4003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  72......GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLVFWQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLL 256
13 -25.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  69ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE------EFTMLNFCQMG-----------SGCTRENLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 259
14 -23.9004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  75......GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLNFCQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERL. 258
15 -23.5004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  58......GKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNF-CLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEH------LEEFTMLNFCQMGSGCTRE-----------NLESIITDFLNHLGIDFKIVGDSCMV-----GDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL 242
16 -22.1002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  88......LELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKK-CLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQH------LNEFTMLNLTELGTPLEER-----------RLEDMARWVLEAAGIREFELVTESSVVY---GDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLL 275
17 -14.6003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  35DFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPASLSWASGKAAESTQVGIERIGE-------EASVDVDM-DVLRLLHEASAAAGVRHHRIVVSH................................................... 188
18 -13.2005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  13  127EIIKNLGIDIDEEKKERLREVLHLYIDGDDLVFEIAKALNVSNEMGLKVLETAFESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSH-----LMSYHSASCVVVG-----------EDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKSKYYTPETQTEVYAYHPEVATFGVYSPIALAKYNIDVPVMNLGLGVERLA 342
19 -12.1003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  22EWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQ-QGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEG------GKPAEFEQLGVELIGDGTASA----------GEVIALMIAALKRAGLSEFKVAIGH................................................... 167
20 -11.8003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  11  222GHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWN---ARDQHDTFFLRDP-EARKNLLRTHTTSASARALRLAQKKPFTPVKYFSIDRVFRNETLDATHLA------EFHQIEGVVAD-----------HGLTLGHLMGVLREFFTKLGITQLRF-KPAYNPYTEPSMEVFSYHQGLEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPT 465
21 -11.4002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  17  178.......................................................SSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGEDATRLYTYFSASCVLV----------------DEELSVDDGKAVAEALLRQFGFENFRFKDEKRSKYYIPDTQTEVFAGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLA 334
22 -10.9006FTT Entity 1(prereleased)  ali follow..  15  13EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDG---ARYCYAGDVIHTLPSGL------FGSRTPLQLGAEIFGCESIAA----------IELIDVLFSMINSLDMSA.......................................................... 151
23 -10.9005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  13EDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDG---ARYCYAGDVIHTLPSGL------FGSRTPLQLGAEIFGCESIAA----------IELIDVLFSMINSLDMSA.......................................................... 151
24 -10.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  98GGLHPITLMERELVEIFRALGYQESEFFNFDALNIPEHHPARDMWDTFWLTGE-VEGRLLLRTHTSPMQVRYMV----AHTPPFRIVVPGRVFRFEQTDATHEA------VFHQLEGLVVG-----------EGIAMAHLKGAIYELAQALFGPDSKVFQPVYFPFVEPGAQFAVWWPEGELGGAGMVHPKVFQAVDAYRERFAFGLGVERLA 323
25 -10.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  35ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITR------GRRREHYQWNMDIIGVKSVSS----------VELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEK................... 213
26 -10.2003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  35EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITR------GRRREHYQWNMDIVGVKSVSA----------VELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQA---GVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGL. 228
27 -10.2002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  44GSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYFEALNLPKSHPARDMQDSF-TDEILMRTHTSPVQARTME--KRNGQGPVKIICPGKVYRRDSDDATHSHQ---FTQIEGLVV--------------DKNIKMSDLKGTLELVAKKLFGADREIVEVDVSCFKCKGKGCNVCKHTGEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIA 257
28 -9.3101z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  28NQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQI--KDSTSARYSYFGKIFRKEKRHK------GRSTENYQIGIELFGESADKS----------LEILSLALQVIEQLGLNKTVFEIGS................................................... 175

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.