current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3iu7_A mol:protein length:288 Methionine aminopeptidase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MASMPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCLLast
1 -122.0003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model  100  1MASMPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL 288
2 -121.0001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  100  1...MPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL 285
3 -115.0004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  48  2...YRYTGKLRPYPLMPTRPVPSYIQRPDYADHPLGMSTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTR. 294
4 -115.0004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  43  3MKTFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSFLHDDSKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANNKSLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTD. 306
5 -114.0002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  48  17EDPYRYTGKLRPYPLMPTRPVPSYIQRPDYADHPLGMSTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTR. 312
6 -110.0003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  46  3......................................GSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTISKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL. 252
7 -109.0003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  33  2................AMGTLEAQTQGPGSMVGLFGR-KKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRARAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTM. 278
8 -109.0001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  36  1..................................MGSDKIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTK. 254
9 -108.0004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  48  1.......................................MTVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTL. 249
10 -108.0003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  31  1........................................MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAQIGYEGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYGVVRDFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNTGTWRMKMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTS. 247
11 -108.0004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  48  78WAGYRYTGKLRPYPLMPTRPVPSYIQRPDYADHPLGMSTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTR. 373
12 -107.0001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  35  1.........................................MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI 249
13 -106.0004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  50  1.......................................MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNQHAVSACLGYHGYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTL. 250
14 -104.0003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  43  48FVNFKFTGDVRPWPLSKINHVPSHIERPDYAISSIPESESDIYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNPTVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTK. 343
15 -102.0004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  30  1........................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFLPLQIGVDGYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLGGPGGLADSCWAYAVGTPSEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPNYGIAGRGLRLREGMVLTIEPMINTGDWEIDTMKTGWAHKTIDGGLSCQYEHQFVITKDGPVILTS. 279
16 -66.6002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  28  2................................................DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPA------FP--VNLSINEIAAHYTPDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGM---EEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRNGIVAQFEHTIIVEKDSVIVTQD. 295
17 -64.8003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  19  1.........MKCILLNQAEELPIEFLPKDGVYGKDSRNMEIENFTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGERNNGI-GFP--AGMSMNSCAAHYTVQDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFKE---NLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYPIRPISDLHGHSISQFRIHGGISIPAVNNRDTTRIKGDSFYAVETFATTGKGSIDDRPPCSHFVLNTGCKVAQFEHTVYLSEHGKEVLTR. 354
18 -61.6005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  20  16........DLYPNGVFPKGQECEYPPTQDGRTATTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHLCDIKGSYTAQFEHTILLRPTCKEVVSR. 368
19 -60.9001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  18  121.......CDLYPNGVFPKGQECEYPPTQDGAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFP--TGCSLNNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVH--DDMECSHYMKNFDVGHVPIRLPRTKHLLNVINE. 408
20 -57.4002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  18  1.......................................EEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKKEKEMKKGIAFPTSISVNNCVCHFSPQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITS. 328
21 -55.6002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  18  2................................GSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKKGIAFPTSISVNNCVCHFSPQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQVIDGEKTIIQNKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDGEFVAQFKFTVLLMPNGPMRITS. 336
22 -52.1005fl8_u mol:protein length:380 ARX1  ali model follow..  15  1.......................................KDKNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDEGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEIPSDDFVVQSGEVYLIDLKMASLEHKAGELIARPGAYVRDSTLVARECNTIVLCDSSVSTTDR. 341
23 -52.1004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  18  1..............................MGMATEKKEADNVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSYRDKKTNKGFSHPTTVSPAAFITPYTPLATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDRQADLFLATYYANEVLLRLMVPPGLLAKISSLLEKVAKAYDCNIIESTTSWLFDKEIEGKKKIILSPNIKGEGVPEVGDVWGVEVGCSLGSGKVKQFEQRATLHRRTNAPVCRLLTTIAITKNGITRIGG. 355
24 -49.6005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  13  4.............SSSGLVPRGSHMLEMALAISHEDTQLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPDAVAAAHIAMETVVALLASGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEREYKGVVWTESHQEADLLSNTDAKDLTVVQSTPFTNVSAIPSDDFVVQSGEVYLID........ 337
25 -47.4004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  13  21..............................SHEDTQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLIQRQLTVPELCLLTDSFILTRLEYKNKVNERGIAIPTTIDIDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIACALTPEKLPASLGGTSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEREYKGVVWTESHQEADLLSNTDAKDLT-VVDRGQSTPFTNVSAIPSDDFVVQSGEVYLIDLKM. 338
26 -44.4005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  27  121......................................GGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESA------FELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGAFAHSLGHGVGLEVHEGPGL----RGTSQDVLEAGMVITIEPGAYL-----------------PGVGGVRIEDLILVTEDGYEVLSHS 344
27 -44.4001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  25  119......................................KDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKP-----AFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVVGSPNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGYFIHSLGHGVGLEIHEWPRI----SQYDETVLKEGMVITIEPGIYI-----------------PKLGGVRIEDTVLITENGAKRLTKT 343
28 -44.1001wn1_A mol:protein length:356 dipeptidase  ali model follow..  23  126......................................KELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIA------FEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGYFIHRTGHGLGLDVHEEPYI----GPDGEVILKNGMTFTIEPGIYV-----------------PGLGGVRIEDDIVVDEGKGRRLTKA 349
29 -44.0001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  24  122......................................RDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKP-----AFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVVGSPNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGYFNHSLGHGVGLEVHEWPRV----SQYDETVLREGMVITIEPGIYI-----------------PKIGGVRIEDTILITKNGSKRLTKT 346
30 -43.7002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  24  128......................................KQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGV-----AFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSIGEPSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGFFGHSLGHGIGLEVHEGPAI----SFRNDSPLPENVVFTVEPGIYL-----------------EGKFGIRIEEDVVLKEQGCEILTTL 352
31 -43.4003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  26  125......................................EKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSS-----SFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGEPSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGYFGHSTGHGIGLEIHEAPGL----AFRSDTVLEPGMAVTVEPGIYI-----------------PGIGGVRIEDDIIVTSEGNEVITKS 349
32 -43.3004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  22  139......................................SELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDV----SFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGYFIHRTGHGLGIDVHEEPYI----SPGNKKILKDGMVFTIEPGIYL-----------------QGKFGVRIEDDVALVDKKGIRLTNA 364
33 -42.8004zng_C mol:protein length:362 Prolidase  ali model follow..  24  134...........................................IKSADEIEKMKVAGDFADKCFEIGTAAERNGVTESDIVAKIEYEMKRMGVPQM-----SFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGYFNHRLGHGIGMDVHEYPSI----VAGNDLVIQEGMCFSNEPGIYI-----------------PGKVGVRIEDCLYVTENGCESFTHT 355
34 -42.6004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  23  166..........................................MCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNG-----STFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIYGTPSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGGLPHRTGHGCGLAIHEAPYL----VRGNRQPLQPGMCASNEPMIVV-----------------PGAFGVRLEDHFYVTDTGAQWFTPP 391
35 -42.0001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  21  157...........................................IKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTEDVELMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDHCSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLQYRTFYGHSFGTLSHYYGREAGLEREDIDTVLEPGMVVSMEPMI-------------MLPEGLPGAGGYREHDILIVNENGAENITKF 391
36 -41.7005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  23  122......................................DVLRQIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKA-----SFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNAESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGYFGHNTGHAIGIEVHEDPRF----SPRDTTTLQPGMLLTVEPGIYL-----------------PGQGGVRIEDVVLVTPQGAEVLYAM 351
37 -41.5001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  19  128.............TLXHRRXLXKALPGTEFVDVGXPVMWXRV-IKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXPYVELMDTWIWFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFLXXVXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFYGHSFGVLXHYYGREAGVEREDIXTVLEPGMVVSMEPMV-------------MXPEGEPGAGGYREHDILVIKENXTENITGF 391
38 -39.3004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  21  149..........................................MVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAFVI------VGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGDPSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAYFVHRTGHGIGLCVHEEPYI----VAGNELPLVAGMAFSIEPGIYF-----------------PGRWGARIEDIVVVTENGALSVNNR 369
39 -37.2005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  18  142......................................LQAFLVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAAGMQAG------HDVNVSFGVNAADSHYEPSEQTLHPGECVLIDLWAQEPGRFADVTWVGFAGEPGTEYLDAWQAVRAAREAALELLRSRFVAEELDRAARDAMGERWAPHFLHRTGHDLGVQIHGAGANLDDYETRDTRTLTPGLSVTVEPGTYPAA----------ASPSGQGGFGIRSEVDVYLAPDGPEVTTDL 393
40 -36.9004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  16  193..............................IMEGEEVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVGDDDIWAVLHAENIKRGGEWI------ETRLLASGPRTNPWFQECGPRITQKNEIIAFDTDLISYGICVDISRTWWIGDQKPRPDMVMQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDDKFQAQKYGCL-MHGVGLC-DEWPLVAY--PGSYDYPLEPGMVLCVEAAVGE----------------VGGDFSIKLEDQVLITEDGYENLTTY 437
41 -35.9004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  16  210..............................IMDGEEVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEWIETRL------LASGPRSNPWFQECGPRVCQRNEIISFDTDLVAYGICTDISRSWWIGDQKPRADMIYAMQHEHIRTNMEMLKPGVMIPELSA--NTHVLDAKFQ---GCLMHGVGLC-DEWPLVAY--AGAYDYPLEPGMTLCVEALISE----------------EGGDFSIKLEDQVLITEDGYENLTKY 454
42 -34.8005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  12  169......................................AYTIAVKEDGELNLMKKAASITSEVFNKFDEKVRHSKLAESVEKAIEEKKYLAGADPSTVEM-CYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDP-SQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKILGFGMGIEFREGSLVIN---SKNQYKLKKGMVFSINLGF-------SDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLT. 419
43 -34.5004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  23  173...........................................FKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGA-----RYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGELGILKG-LSHWLGMDVHD---VGDYGSSDRGRILEPGMVLTVEPGL--------YIAPDADVPPQYRGIGIRIEDDIVITATGNENLTA. 420
44 -34.5005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  24  175...........................................YKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKGGA-----KMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPAGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGRLGLLEG-AGHWLGMDVHD---VGEYRVGGEWRVLEPGMAMTVEP-------GIYIAPDNTTVAKKWRGIGVRIEDDVVVTRNGCEVLTN. 423
45 -33.7005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  13  192......................................SALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKEETEKVILDPAKVNCKLKADNYPPIFQSGGKFDLRPSAVSNDYYDSASVIICAVGARYKSYCSNIARTFLIDA-DPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDAPDMVSCLAGTGIGIEFRESGLNIN---AKNDQIVKEGMVFNVSLGFQN--------LHCENSKSKNKVFSLLLADTIIINKDKTDVVTS. 445
46 -33.6001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  23  175...........................................FKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGA-----RYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGKLGILKG-LSHWLGLDVHDVGVY----GQDRSRILEPGMVLTVEPGL--------YIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTA. 421
47 -33.6005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  20  195...........................................IKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGA-----DILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKDLGIMKN-VGHYLGMDVHDTPDM------PRSLPLQPGMVITIEP-------GIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSA. 439
48 -33.4003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  19  171...........................................FKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGI-----KHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPAGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGAVGLIQE-VSHFLGLDTHDVGTY-------KDRVLEEGMVITIEP-----------------LYIEEESIGIRIEDDILVTKDGHENLSK. 399
49 -33.0003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  10  172......................................AKCLAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNEAFFQTKSLKLGYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFDP-DSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKRPDLEPNFLGAGIGIEFRESSLLVN---AKNPRVLQAGMTLNLSI-------GFGNLINPHPKNSQSKEYALLLIDTIQITRSDPIVFTDS 430
50 -32.5002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  22  187...........................................FKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGG----MRHSSYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPAGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEEHMGILSG-LGHFLGIDVHDRIDEPGLRSLRTARHLQPGMVLTVEPGIALADPARASFFNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCV 469
51 -32.4006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  13  171......................................SSLWAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKSRFLKKLS---AYSPIIQSGPKYDLRVSASSETQLDGNGCILASCGIRYKNYCSNISRTFLIDP-SDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSKKPELSAGFVGSLMGLEFRDSQFVLN--NKNDYRKVENGDCFNISLGFNN------------KDSKTGASYALQLADTVQLTSGGPKVLTNY 434
52 -31.4004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  17  161...........................................FKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVP------YSNIVALNEHAAVLH---DHQAPEEMRSFLLDAGAEYNGYAADLTRTWS-AKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLKHQIITD-IGHPLGLQVHDLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKHFNWQKGIRIEDNVVIHENNVENMTR. 438
53 -31.3003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  12  172......................................SKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVTNAKLSDKIENKIDDVKFLKQLSPDLTYSPIIQSGKKFDLVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFIGSLIGLEFRDSNFILN--VKNDYRKIQRGDCFNISFGFNNLKDS-----------QSANNYALQLADTVQIPLDETEPPRFL 435
54 -29.7003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  17  159...........................................YKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDNP------YGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCHQRVAQTDFNIVDL-LGHHIGLQVHDQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTR. 435
55 -29.5003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  16  159...........................................YKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQGDNDVP------YTSIVALNEHASILH--CDTVAPKESRSFLIDAGANYHGYAADITRTYAQEGNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQIDTGMVNL-IGHFLGLQVHDVGGLVNDDRGRCTRMVEARQVFTIEPGLYFIDSLLRDLKATPASKYINWDTGIRIEDNIIVHRDKNENMTR. 438
56 -29.3004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  17  159...........................................YKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQHSENDTP------FGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQTDFNIVNL-LGHHIGLQVHDQEPPEGHPFLRCTRKIEANQVFTIEPGLYFIDSLLGDLAATDNNQHINWDKGIRIEDNIIVHEDSLENMTR. 435
57 -19.4004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  15  330...........................................TKNDHEMQGMRNSSAALVEFLCWLEKELLSGKRYTEIE--LADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLV---LKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFTGHGVGHYLHEGPIGIGHRSVPTGGELHASQVLTIEP------------------FYAKEKYGIRIENCYETVEAVVM..... 560
58 -17.9005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  15  355...........................................VKNDVEIDNMKQAGLALLQFFHWCEQKRKTKELFNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIH--DKTNATIKPAIYLLDSGGQYLHGTTDVTRTTHFGEPTAEEKRIYTLV---LKGHLRLRKVIFASYTNSSALDFIARENLFNNFMDYTGHGVGLTLHEGGC-----GPVGGAPLKKNMVLSNEP------------------YYMKDKFGVRIENMQYVISKSFDDLTMY 596
59 -17.5003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  18  293...............KASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEIAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYV---LKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYTGHGVGSFLHEGPCGISY-KTFSDEPLEAGMIVTDEP------------------YYEDGAFGIRIENVVLVVPVKTK..... 548

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;