current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3kf6_A mol:protein length:159 Protein stn1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst SLENENQLTHQFPTLSRWNPMFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHHSIIRTLast
1 -78.9003kf6_A mol:protein length:159 Protein stn1  ali model  100  1SLENENQLTHQFPTLSRWNPMFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHHSIIRT 159
2 -59.0004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  17  1..........LDPVFLAFAKLYIRDILDMKESRQ-VPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPNIQIARMLELPTIYRKVYD--QPFHS.... 166
3 -57.0003kf8_A mol:protein length:220 Protein stn1  ali model follow..  21  36....VIELFHQAPTFDKTIPLFISDINNSPNLYGILRHVVLVNNYPVNQINIFGKIVYEQYKESYVILVISDFIGIDSKIRVRLSQEQEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELDGLHFEFEQWKKRMEFRKNNLV--EPWVFIPTP 217
4 -52.3004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  13  1.........GKKAGNNTLRPVTIRQILNAEQPHP--DAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDD-SSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR........... 136
5 -51.4002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  18  29SPAPSQAEKKSRARAQHIVPCTISQLLSATL----VDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDT-SSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAP 182
6 -39.0003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  16  23...............SPPLKVLAEQLRRDAEGGPGARAAAGRGPLDLAAVWMQGRVVMADRGE----ARLRDPSGDFSVRGL-----ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDPIHESMWELEVEDLHRNI............. 149
7 -39.0003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  17  20...............SPPLKVLAEQLRRDAEGGPLSRAAAGRGPLDLAAVWMQGRVVMADRGE----ARLRDPSGDFSVRGL-----ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDPIHESMWELEVEDLHRNI............. 146
8 -19.0001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  14  26....................TTVESAKSLRD----------------TWVTLRGNIVERISDDL---YVFKDASGTINV------DIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVN................................ 108
9 -14.6004gla_C mol:protein length:109 OBody NL8  ali model follow..  17  21...............................................TEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHKVFAELSREDVVVIKGIVEA-GRGVEIFPSEIWILNKAKA............................ 109
10 -13.8004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  17  19...............................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHKVFAELSREDVVVIKGIVEATTVTREIFPSEIWILNKA.............................. 107
11 -13.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  16  19...............................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHKVFAELSREDVVVIKGIVEAGWPVAEIFPSEIWILNKAKP............................ 109
12 -13.5002k5v_A mol:protein length:104 Replication protein A  ali model follow..  15  10.............................................PNLSGTINAEVVAAYPKKEFSRLFLKDDTGSIRGTLWNELADFE-------VKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLE............................ 98
13 -13.5004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  17  20...............................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHKVFAELSREDVVVIKGIVEASEQYGEIFPSEIWILNKA.............................. 108
14 -13.2002kbn_A mol:protein length:109 Conserved protein  ali model follow..  16...............................................QWANLKAKVIQLWENTHEQVGLLGDETGIIKFTIWKNAELPL-------LEQGESYLLRSVVGEYNDRFQVQVNKNSSIEKLSEPI.......................... 98
15 -13.1003e0e_A mol:protein length:97 Replication protein A  ali model follow..  14  10.............................................PNLSGTINAEVVTAYPKKEFSRLFLKDDTGSIRGTLWNELADFE-------VKKGDIAEVSGYVKQGYSGLEISVDNIGIIE................................ 94
16 -13.1005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  21...............................................KIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVC---DPSSKAYEKALEVRSEFVLVAKGKVRL-TGKIEIVLEELIIENKS.............................. 109
17 -12.9004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  16  23...............................................TEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHKVFAELSREDVVVIKGIVEASKAAAEIFPSEIWILNKAK............................. 113
18 -12.7004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  112.................................................VNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKT-------KCEEGDKIRLTFEVSKNGVKIQLKSGPCSFFKVIKAA........................... 188
19 -12.7001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  16  17...............................................KKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEETFEKAKKLGRESSVIVEGIVKA-PGGAEVHVEKLEVIQAVSEFP.......................... 105
20 -12.6005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  10  15...............................................KNLNLIFIVLETGRVTKTRTCKVADKTGSINISVW--------DDVGNLIQPGDIIRMTGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFS................ 109
21 -12.5003dm3_A mol:protein length:105 Replication factor A  ali model follow..  15  15...............................................MTATFEGEVISALPIKELKSFIVRDETGSIRVTLWDNLTDID-------VGRGDYVRVRGIREGYYGGLECTANYVEILKKGEKI........................... 103
22 -12.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  17...............................................QKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKEILPEKIVVLNRAETPL.......................... 105
23 -12.3004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  10  124...............................................TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNI-------NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIKG............................... 198
24 -12.2003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  125.................................................VNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTM-------KCKEGDKVRLTFTLSKNGEKLQLTSGVHSTIKVIKAK........................... 201
25 -12.1001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  17....................VKVEQLKP------------------TTGHTLTVKVIEANQPSRIVECLIGDETGCILFTAR--------NDQVDLMKPGATVILRSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYESGP........ 142
26 -12.0004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  11  9....................YLPWEVSAGQVPDG-------------STLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLV------CTKLVEPFHAQVGSLYIVLGELQHQQDRGVVKARVLTCVEGMN--LPLLEQAIREQRLYKQ........... 116
27 -12.0002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  13  14...............................................PYVSVIGKITGIHKKESVYQGYIEDDTARIRISSF-----------GKQLQDSDVVRIDARVAQFNGYLSLSVGDSSRIESVNVNI.......................... 97
28 -11.9004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  12  5....................TFVKDIKP------------------LKNLNLIFIVLETGRVTKTRTCKVADKTGSINISVW--------DDVGNLIQPGDIIRLTGYASVFKGCLTLYTGRGGDLQKIGEF........................... 98
29 -11.8001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  17  13...............................................ESVNVTVRVLEASEVRTISEAIVGDETGRVKLTLW--------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASED........................... 99
30 -11.8004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  15  124...............................................RLVDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSV-------NCEIGNTIRLVCELTSNADEWFLRATRYSYMEVIMPE........................... 202
31 -11.7002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  17  13...............................................ESVNVTVRVLEASEVRTISEAIVGDETGRVKLTLW--------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASED........................... 99
32 -11.1002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  11  127.................................................NIVYGVFMLHKVNQKTTIYEIQDDRGKMDVVGTGQCHNI-------PCEEGDKLQLFCRLRKKNQMSKLISSFIQIKKKTN............................. 206
33 -11.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  72...............................................EVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKAANINKESIVDVEGVVRKVNQDVELHVQKIYVISLAEPRL.......................... 166
34 -10.9004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  10  120...............................................TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNI-------NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK................................ 193
35 -10.9002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  10  7....................IEGRHMVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIEL-----------MEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSH-PFDLGLYNEAVKIIHDFPQF.......... 123
36 -10.9005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  15  44...............................................QRVKVFGWVHRLRRQGKNLMFVLRDGTGYLQCVL---ADELCQCYNGVLLSTESSVAVYGMLNLTPKGKELSCDFWELIGLAPAGG.......................... 133
37 -10.8003f1z_A mol:protein length:133 putative nucleic acid-binding lipoprotein  ali model follow..  18...........DDAVASMQTYSVAQFLQPFTLNPAKASSDYLG----KWVKVRGVIVDIRRAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK................................ 133
38 -10.7001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  17  17...............................................KEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVV---DKNSSAFGISQELTQESVIQVRGIVKA-PRGIELHAEEITLLSKAKAPL.......................... 102
39 -10.7004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  10  124...............................................TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNI-------NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK................................ 197
40 -10.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  31...............................................KLVTFKGWAYHIRKARKTLIFELRDGSGYCQCVI--FGKELCEPEKVKLLTRECSLEITGRLNAYAGKNEMQVTEWKVIGESPIDL.......................... 126
41 -10.6002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  11  17...............................................AETPVTGRVMKISSPRTFTTVIIADDTGELRAVFW-----TENIKLLKKFREGDVIRIKDV-GGFGGRKEAHLMPRSTVEVLDPL........................... 108
42 -10.5003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  10  63...............................................KTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQCQKISAESICDITGIVKAVEQDVEIHVTSIAVVSLAEYPL.......................... 157
43 -10.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  1..................MRVLVRDLKAHVG----------------QEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVT----------GGLKLPLPESALRVRGLVVE-PGGLEVQAKEVEVLSPALEPT.......................... 92
44 -10.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  16  1..................TGVKIRDLVKHRN----------------ERVCIKGWIHRMRRQGKSLMFILRDGTGFLQVLL---MDKLCQTYDALTVNTECTVEIYGAIKEVPEGKELIADFWKIIGNAPPG........................... 102
45 -10.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  19...............................................QEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVF--DPDRAETFAKADRVRSEFVVKITGKVRL-SGSIEVLGYELEVLNQAETPPF---EETRLRYRFIDLRRP....... 137
46 -9.9901eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  14  16...............................................QQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFF--DPDRADALKLASELRNEFCIQVTGTVRA-TGEIEVLASSLTIINRADVLPLDSNEEARLKYRYLDLRRP....... 132
47 -9.9001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  40...............................................KEVLFRARVHNTRQQGATLAFTLRQQASLIQGLV-EGTISKNMVKWAGSLNLESIVLVRGIVKKVDQNLEIHITKIYTISETPEAL.......................... 137
48 -9.8901efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  19  17...............................................EEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVA---HPASPAYATAERVRPEWVVRAKGLVRLATGRVEVELSALEVLAEAKEEEKEASEELRLKYRYLDLRRR....... 138
49 -9.8204ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  16  81...............................................LEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLRTNKGELSVKCTQLRLLA................................ 161
50 -9.8003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  16  57...............................................IEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLGDIVGVRGTMKTKVGELSIKVSSYEFLT................................ 137
51 -9.6205w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  33...............................................QQVTLAGWVARRRDHGGVIFIDLRDASGIAQ-VVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEI-TGEIEVNATSLTVLGECAPLPFQLDEELRLKYRYLDLRRD....... 150
52 -9.5704ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  16  25...............................................QEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVKMPTGEIEIKVKTAELLNACKKLPFE--EALRLQYRYLDLRSF....... 142
53 -9.3003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  44..............................................VNHCVMLGVVQNIQEGDKVLQFTLSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLR------------MVPQYDGSMRKYYHYPVIQV................. 138

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.