current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3kf8_A mol:protein length:220 Protein stn1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst PLGSKDNRLLYPKTKIDWGPGENHICLKTPFKNFYVIELFHQAPTFDKTIPLFISDINNSPNLYGIYNYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPTPQRELast
1 -107.0003kf8_A mol:protein length:220 Protein stn1  ali model  100  1PLGSKDNRLLYPKTKIDWGPGENHICLKTPFKNFYVIELFHQAPTFDKTIPLFISDINNSPNLYGIYNYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPTPQRE 220
2 -57.1004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  1.........................................LDPVFLAFAKLYIRDILDMKESRQ--------VPGVFLYNGHPIKQVDVLGTVIGVRER--------DAFYSYGVDDSTGVINCICWKKLNTESVSAAEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDP----------VWNIQIARMLELPTIYRKVYDQPFH........ 165
3 -57.0003kf6_A mol:protein length:159 Protein stn1  ali model follow..  21  5...................................ENQLTHQFPTLSRWNPMFISDVHKISFHPHL-------QRYIGFWMGFPIRWIQIVGYIAAIDIY--------EGKHVLTVDDCSGMVLRVVFIIQDDF--SMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEEL------------RDPNDEWKAWQKRMRYKKNLTKKNHHSIIRT... 159
4 -40.7004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  1........................................GKKAGNNTLRPVTIRQILNAEQPHP---------DAEFILDGAELGQLTFVAVVRNIS--------RNATNVAYSVEDGTGQIEVRQWLDSSSDDSS---KASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPV------------IDYNEVMFHRLEAVHAHLQV.............. 134
5 -36.1002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  11  44..............................................QHIVPCTISQLLSATL-----------VDEVFRIGNVEISQVTIVGIIRHAE--------KAPTNIVYKIDDMTAAPMDVRQWVDTDDTSS---ENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPL------------EDMNEFTTHILEVINAHMVLSKAN.......... 173
6 -33.1003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  12  24...............................................PPLKVLAEQLRRDAEGGP---GAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGE------------ARLRDPSGDFSVRGL-------ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLS-----------DNPIHESMWELEVEDLHRNI.............. 149
7 -33.0003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  12  21...............................................PPLKVLAEQLRRDAEGGP---GAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGE------------ARLRDPSGDFSVRGL-------ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLS-----------DNPIHESMWELEVEDLHRNI.............. 146
8 -15.8001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  18  38.....................................................................................TWVTLRGNIVERISDDL-----------YVFKDASGTINV--------DIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVN............................................. 108
9 -14.1003e0e_A mol:protein length:97 Replication protein A  ali model follow..  15  10...................................................................................PNLSGTINAEVVTAYPKKEFSRKDGTKGQLLFLKDDTGSIRGTLWNELADF---------EVKKGDIAEVSGYVKQGYSGLEISVDNIGIIE............................................. 94
10 -14.0002k5v_A mol:protein length:104 Replication protein A  ali model follow..  15  10...................................................................................PNLSGTINAEVVAAYPKKEFSRKDGTKGQLLFLKDDTGSIRGTLWNELADFE---------VKKGDIAEVSGYVKQGYSGLEISVDNIGIIE............................................. 94
11 -13.4002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  15  14.....................................................................................PYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFG-------------KQLQDSDVVRIDARVAQFNGYLSLSVGDSSRIE............................................. 91
12 -13.3004gla_C mol:protein length:109 OBody NL8  ali model follow..  10  21.....................................................................................TEVVVAGWVASLGDY--------GRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEA-GRGVEIFPSEIWILNKAK.......................................... 108
13 -12.9004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  12  19.....................................................................................SEVVVAGWVAHLGDY--------GRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEA---TTVTRWDTGVEIFPSEIWILNKA................................... 107
14 -12.8004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  13  23.....................................................................................TEVVVAGWV--------ASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHN----EIFPSEIWILNKAK.................................. 113
15 -12.5004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  13  19.....................................................................................SEVVVAGWVAHLGDY--------GRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEA---GWPVALDTGVEIFPSEIWILNKAKP................................. 109
16 -12.5003dm3_A mol:protein length:105 Replication factor A  ali model follow..  11  13...................................................................................PGMTATFEGEVISALPIKEFKRADGSIGKLFIVRDETGSIRVTLWDNLTDI---------DVGRGDYVRVRGIREGYYGGLECTANYVEILKKGE.......................................... 101
17 -12.5004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  13  20.....................................................................................SEVVVAGWVAHLGDY--------GRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEA---SEQYGSATGVEIFPSEIWILNKA................................... 108
18 -12.1001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  13.....................................................................................ESVNVTVRVLEASEARQIQTKNGVRTISAIVGDETGRVKLTLW----------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQIPENTPTAPQQM..................... 118
19 -11.7002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  13.....................................................................................ESVNVTVRVLEASEARQIQTKNGVRTISAIVGDETGRVKLTLW----------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQIPENTPTARRR...................... 117
20 -11.6005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  15.....................................................................................KNLNLIFIVLETG--RVTKTKDGHEVRTCKVADKTGSINISVW----------DDVGNLIQPGDIIRMTGYASVFKGCLTLYTGRGGDLQ............................................. 93
21 -11.3002kbn_A mol:protein length:109 Conserved protein  ali model follow..  14  16.....................................................................................QWANLKAKVIQLWE-----NTHESISQVGLLGDETGIIKFTIWKNAELP---------LLEQGESYLLRSVVGEYNDRFQVQVNKNSSIE............................................. 92
22 -11.3001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  26....................................................................................TTGHTLTVKVIEANIVVPVTRKTRPASSLCLIGDETGCILFTAR----------NDQVDLMKPGATVILRSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEY......................... 138
23 -10.9001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  14  43.....................................................................................TIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLP-VIKQVGQPLLLHQTLRSYRDRTQGLSKDQFRYAL............................................ 133
24 -10.6002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  15...................................................................................EGAETPVTGRVMKISSPRTFTTRKGREGKLVIIADDTGELRAVFWTENIKLL-------KKFREGDVIRIKDV-GGFGGRKEAHLMPRSTVEV............................................ 104
25 -10.5004dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model follow..  15  3....................................................................................GSNALMIGRIADVQHGFLGAMTVTQ--YVLEVDGGASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRM............................................................. 75
26 -10.2004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  12  5...................................................TFVKDIKP-------------------------LKNLNLIFIVLETG--RVTKTKDGHEVRTCKVADKTGSINISVW----------DDVGNLIQPGDIIRLTGYASVFKGCLTLYTGRGGDLQ............................................. 93
27 -10.2001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  40.....................................................................................KEVLFRARVHNTRQQ-------GATLAFLTLRQQASLIQGLVKANKEGTISKNMVKAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALNLDTRLDYRVIDLRTVTNQAIFRIQAGVCE. 189
28 -10.0004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  10  23.....................................................................................STLRTFGRLCLYDMIQS----------RVTLMAQHGSDQHQV------LVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSV----VKARVLTCVEGM---------NLPLLEQAIREQRLYKQE........... 117
29 -9.9204j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  14  72.....................................................................................EVVWVRARVHTSR--------AKGKQCFLVLRQQQFNVQALV-AVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLNQDTRLDNRVIDLRTSTSQAVFRLQSGICH. 218
30 -9.8401x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  12  17.....................................................................................KKVRLAGWVYTNM--------RVGKKIFLWIRDSTGIVQAVV--AKNVVGEETFEKAKKLGRESSVIVEGIVKA-PGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIM. 143
31 -9.7303en2_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  12  2....................................................................................INRLQLVATLV--EREVMRYTPAGVPIVNCLLSYSGQAARQVEFSIEALGAGKMASVLDRIAPGTVLECVGFLARKHRSSKALVFHISGLE............................................. 95
32 -9.7304fdb_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  10  2....................................................................................INRLQLVATLV--EREVMRYTPAGVPIVNCLLSYSGQTARQVEFSIEALGAGKMASVLDRIAPGTVLDCVGFLARKHRSSKALVFHISGLE............................................. 95
33 -9.6703fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  1....................................................................................MNTLELSARVL--ECGAMRHTPAGLPALELLLVHESGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSV-------KLHLQQARRIAGSMGR................................ 102
34 -9.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  31.....................................................................................KLVTFKGWAYHIR-------KARKTLIFVELRDGSGYCQCVI----FGKELCEPEKVKLLTRECSLEITGRLNAYALNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQW. 164
35 -9.5803f1z_A mol:protein length:133 putative nucleic acid-binding lipoprotein  ali model follow..  22..............................................ASMQTYSVAQFLQPFTLNPAKASSDYLG-----------KWVKVRGVIVDIR--RKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSAD----VEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK............................................. 133
36 -9.4705gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21.....................................................................................KIVKVAGWC--------NTYRDHGGVVFIDLRDKSGLVQLVC-----DPSSKAYEKALEVRSEFVLVAKGKVRL-TGKIEIVLEELIIEN............................................. 107
37 -9.4502oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  11  127.......................................................................................NIVYGVFMLHK------KTVNQKTTIYEIQDDRGKMDVVGTGQCHNI---------PCEEGDKLQLFCRLRKKNQMSKLISEMHSFIQIKK.......................................... 203
38 -9.3105xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  44.....................................................................................QRVKVFGWVHRLR-------RQGKNLMFLVLRDGTGYLQCVL-----ADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQ--APGGHELSCDFWELIGLAPAGGDVDVQLNNRHMMIRGENMSKILKARSMVTR. 172
39 -9.0604lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  10  78.......................................................EINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIGTLIYGVFAVEK-KKVNDKSITFKIKDNEDNIKVVWDKEQHNI---------NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIKGEKL......................................... 197

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24