current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3lhl_A mol:protein length:287 Putative agmatinase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MSLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKEGLast
1 -108.0003lhl_A mol:protein length:287 Putative agmatinase  ali model  100  1MSLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKEG 281
2 -91.9003nio_A mol:protein length:319 Guanidinobutyrase  ali model follow..  27  33..AELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGEKIAHGTTFRRAVELLDCDRVVQIGLRAYTAEDFNWSRKQGFRVVQAEECPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGC--QGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR. 319
3 -91.9001gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE  ali model follow..  26  24.DPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDLIDPAAMVQIGIRGHKPDSLDYARGHGVRVVTADEFGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCV--GDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHRT. 311
4 -91.2004dz4_A mol:protein length:324 Agmatinase  ali model follow..  26  41.TRDLDGVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPYPWGFFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPDSLNHGTMFYKAVKLIDPKASVQVGIRTWNDDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGL--GGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRKAGA 323
5 -90.8003pzl_A mol:protein length:313 Agmatine ureohydrolase  ali model follow..  31  28AVNGYEEAKYVVFGIPFDNTSSYRRGSKYAPDSIRGAYVNLESYEYSYGIDLLASGMADLGDMEES-EDVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRAL---PKDVDLVIVDAHSDFRSSYMGNKYNHACVTRRALDLLGEGRITSIGIRSVSREEFEDPDFRKVSFISSFDVK-IDKYIEEVKSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERL---SYKAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYYKE. 303
6 -88.7001wog_A mol:protein length:305 agmatinase  ali model follow..  26  25...GDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFAD-VPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACELPNLVHITTVGLRGLDPEAVAAARARGHTIIPMDDVTLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAA-ANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHV... 304
7 -86.6003nip_A mol:protein length:326 3-guanidinopropionase  ali model follow..  26  30..TDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYGDNPYTHGTPFRRAIELLDPLRTVQIGIRGSSPDDDAFARECGIRVIHMEEFATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGL--RGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAAR. 316
8 -82.8003m1r_A mol:protein length:322 Formimidoylglutamase  ali model follow..  24  33..DGQDIKGPALIGVPLSKSSISHSGASFAPGTIRQALKHSSAYSAELGEHVVSELLYDLGDIDIHVTDIVKSHHHIFQTMHALLSDHPVPLILGGDNSISYSTIKAIAQTKGTTAVIQFDAHHDVRNTEDG-GPTNGTPFRRLLDIIEGQHLIQLGIREFSQAYEAYAKKHNVNIHTMDMIPTIKEILPVVQDDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELLEAVKYIA-QQPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSPFK. 322
9 -78.7004rhm_A mol:protein length:351 Arginase  ali model follow..  21  15......MFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFDAHPDVSD--------PRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIY-LFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGI--RGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHT 320
10 -75.6002a0m_A mol:protein length:316 ARGINASE SUPERFAMILY PROTEIN  ali model follow..  18  18.AQREEDADIVIIGFPYDEGCGGRAGAKKGPAAFRFFLQRLGSVNNLELVDASHLKLYDAGDITAS--TLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFGDVGVINVDSHLDVRPPLQDGRVHSGTPFRQLLESFSGKRFVEFACQGSGALHAQYVRDHQGHLMWLSEVAALEDAFGLTG-KNTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAG-KTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATRPKP. 306
11 -75.4004rhi_A mol:protein length:351 Arginase  ali model follow..  19  18.....KFLMNVKGVTPRG----SDWANRLGPVALFGYGAGMPRRAPLLDFFYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPDIVIVHFSARPSVSD--------PRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIY-LFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGI--RGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHT 320
12 -73.4001pq3_A mol:protein length:306 Arginase II, mitochondrial precursor  ali model follow..  21  2........SVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSGNLHGQPVSFLLRCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTG-LLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG 306
13 -71.9001wva_A mol:protein length:322 Arginase 1  ali model follow..  21  2...SAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTSGNLHGQPVSFLLKCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTG-LLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREG 310
14 -71.9001d3v_A mol:protein length:323 PROTEIN (ARGINASE)  ali model follow..  21  2...SSKPKPIEIIGAPFSKG-QPRGGVEKGPAALRKAGLVEKLKETEYNVDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSGNLHGQPVAFLLKCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTG-LLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREG 310
15 -71.5001t5f_A mol:protein length:314 Arginase 1  ali model follow..  21  2........PIEIIGAPFSKGCP-RGGVEKGPAALRKAGLVEKLKETEYNVDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLAVIWVDAHTDINTPLTTSSGNAGQPVAFLLKAISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTG-LLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTKREG 305
16 -69.3002eiv_A mol:protein length:291 Arginase  ali model follow..  22  3........RVAVVGVPMDLGAN-RRGVDMGPSALRYARLLEQLEDL-------GYTVEDLGDVPVSLARASRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAAR-GRRVGVVWVDAHADFNTPESPSGNVHGMPLAVLSGLVDPKDVVLVGVRSLDPGEKRLLKEAGVRVYTMHEVDIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILA-ESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI...... 290
17 -67.0005ynl_A mol:protein length:362 Arginase  ali model follow..  19  45..FLATPRTAGIVGCPFSGG-QPKAGVHSGPLQLIESGLLNDIENLGWTVDLAVSIVSDTPDPDIGRLKVSRVTKDVADRVYAHASKGQLTVTLGGDHSLAMGTVSGTFKAYPEACLIWVDAHADINTPHTTSGRLHGCPVSFLLGCLKPERIVYIGLRDIDAGERKILKDNNIKCFSMFHVDVVEMALDHVRTRPIHLSFDVDALDPSVAPSTGTAVRGGLTFREGHYICEAIA-ETNLLVSLDIMEINPSLGALASVA-QTVDVGRSLVRCALGET... 354
18 -65.9004ity_A mol:protein length:330 Arginase  ali model follow..  20  1MRGSGMAKKMSIVLAPFSGGQP-HSGVELGPDYLLKQGLQQDMEKLGWDTRVEARKASDNGDRIGRVKRPRECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSVHPDAGVIWVDAHADINTMSGTSGNLHGCPLSILLGVLKPNKIAYIGLRAVDDEEKKILHDLNIAAFSMHHVKVVSMAIEAVGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIAECG-RLVALDVVECNPLLAATESHVNDTISVGCAIARCMMGETLLY 316
19 -65.8001xfk_A mol:protein length:336 Formimidoylglutamase  ali model follow..  21  37.ELANQEPGVALIGFECDAGVKGRTGAKHAPSLIKQALANLAWHH--------PIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHFPRIGIINFDAHFDLRSELAPVRPSSGTPFNQIHHFCQQQHYACLGVSRASNTPALFERADKLAFSPLSLKDHLTQLQHFIDDDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKNKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSI 333
20 -65.6006dkt_A mol:protein length:296 Arginase  ali model follow..  23  2......DKTISVIGMPMDLGQA-RRGVDMGPSAIRYAHLIERLSDM-------GYTVEDLGDIPINRNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLESPSGNIHGMPLAVSLGKIKPENVVIIGARSLDEGERKYIKESGMKVYTMHEIDVIEETLDYLSADGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAG-IITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKL...... 295
21 -65.4001cev_A mol:protein length:299 PROTEIN (ARGINASE)  ali model follow..  22  3........PISIIGVPMDLGQT-RRGVDMGPSAMRYAGVIERLERLHYDIEGKAERLHEQGDSRLRNKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAESPSGNIHGMPLAASLGKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDVMEETIAYLKEDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLA-EAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKL...... 298
22 -63.6004g3h_A mol:protein length:330 Arginase (RocF)  ali model follow..  17  1.........MILVGLEAELGAS-KRGTDKGVRRLREALSATHGDVIKGMQTIRCVLYKEFRYAKNFEDYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKKIGILYLDAHADIHTAYDSSKHIHGMPLGMVLNRIDPKCLVYFGVRSTEQSERDVIRELQIPLFSVDAIRVVQKTKESLKADIIYLSLDLDIMDGKLFTSTGVRENNGLSFDELKQLLGLLLESKDRLKAVEVTEYNPTVSIKHNNEKQVLEILDLIINSCKIKDKKH 316
23 -61.8004q3p_A mol:protein length:385 Arginase  ali model follow..  20  31.KPKLLYTSANFLGIPTNRG-QPKIGTYQGPELIRKSNFFQLVAEDGIQLDCGDIIPVELNEAEDPQERVEELMKQSNKHTVELSGSKSTPVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSSGNMHGMPLSFLVKCLNASNIAYIGLRDLDAHETHDIRKHGIAYFTMLDVDVIKEALLAVLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATG-KLSVVELAELNPLLGSQEKTQSSAVHILRACLGHCRSGHLP. 357
24 -58.3003mmr_A mol:protein length:413 Arginase  ali model follow..  20  78.TNNYINNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNGYVNYEENNVISTNDKYKNNKEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPESPSGNYHGMTLAHTLGLLKPENTAIIGIRDIDAYEKIILKKCNINYYTIFDINTICTALEKISNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILA-ETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLE. 396

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.