current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst GPGSMMTEATTTPVETPIVCNIRDAAGLEGKLVTFKGWAYHIRKARKTLIFVELRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEPLast
1 -142.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model  100  1GPGSMMTEATTTPVETPIVCNIRDAAGLEGKLVTFKGWAYHIRKARKTLIFVELRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
2 -127.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  47  15.MAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELC-QCYNGVLLSTESSVAVYGMLNLTPKGKQ-----APGGHELSCDFWELIGLAPAGGANLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHENPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 466
3 -125.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  47  1.................TGVKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQT-YDALTVNTECTVEIYGAIKEVPEGKE-----APNGHELIADFWKIIGNAPPGIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLINPKFQPPERPFLRMEYKDAIKWLQEHNVENEGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
4 -123.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  23  41ERYGISSMIQSQEKPDRVLVRVRDLIQKADEVVWVRARVHTSRAKGK-QCFLVLRQQQFNVQALVAVGDHASKQMAANINKESIVDVEGVVRKVNQK---IGSCTQQDVELHVQKIYVISLAEPRLPEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRG-EEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
5 -121.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  24  9GKLPLIQSRDSD-RTGQKRVKFVDLDKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTVKWAGSLNLESIVLVRGIVKKVDEPIKS---ATVQNLEIHITKIYTISETPEALPAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRG-EEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
6 -121.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  28  3..............RTHYSSEITE--ELNGQKVKVAGWVWEVKDLGG-IKFLWIRDRDGIVQITAPKKKVDPEKLIPKLRSEDVVAVEGVVNFTPKAKL--------GFEILPEKIVVLNRAETPLPLDPTVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYRG-VEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
7 -121.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  35  3.................EKVYCQEVPELDGKKVRLAGWVYTNMRVGK-KIFLWIRDSTGIVQAVVAKNVVGEEEKAKKLGRESSVIVEGIVKADER--------APGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRTTLKNTEPPFPRISYDEAIDILQSKGVNVE-----WGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAPGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
8 -120.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  26  2................YRSHFIADVPEYDGKEVIWAGWVHLLRDLGG-KKFIILRDKTGLGQVVVDKNS-SAFGISQELTQESVIQVRGIVKADKRA--------PRGIELHAEEITLLSKAKAPLPLDVSVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGD----DIGTPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIYKF-LEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
9 -119.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  29  1.................MRVLVRDLKAHVGQEVELLGFLHWRRDLGR-IQFLLLRDRSGVVQVVTGGL--------KLPLPESALRVRGLVVENAK--------APGGLEVQAKEVEVLSPALEPTPPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVG-QDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLFRG-LEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
10 -114.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  26  33KVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGN-MVFLFLRKGIYTCQALVMKSETISKEFCQKISAESICDITGIVKAVEKPI---EKATQQDVEIHVTSIAVVSLAEYPLPAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRG-QEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
11 -92.6001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  24  2..............................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIMGLKKIFVLSPNIRLEQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTK--------RFEVFEYSEVLEEFGS--------------------DEKASQEMEEPFWIINIPREFYDREVDGFWRNYDL-----ILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPA. 292
12 -90.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  22  2..............................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIMGLEKIFVLSPNIRLERKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRAR--------HFKVYDYKDILEEFGS--------------------DEKASMEMEEPFWIVNIPREFYDREENGVWKNYDL-----ILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAV 293
13 -87.6001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  2.............RRTHYAGSLRE--THVGEEVVLEGWVNRRRDLGG-LIFLDLRDREGLVQLVAHPASPAY-ATAERVRPEWVVRAKGLVRLRPEPNPRLA---TGRVEVELSALEVLAEAKTPPFPVDAGEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHGLFYALPQSPQLFKQLMVAGLDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGVFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAAEWDEEEEAWTYMHHPFTSPHPEDLPLL---EKDPGRVRALAYDLVLNGV-EVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDP 557
14 -86.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  4.............MRSHYCGQLNE--SLDGQEVTLCGWVHRRRDHGG-VIFLDVRDREGLAQVVFDPDRAETFAKADRVRSEFVVKITGKVRLRPEGARNPNMAS-GSIEVLGYELEVLNQAETPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTGHFFALPQSPQLFKQLMVAGFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDV--------------EFDEFPHMPFEEAMRIKVGHDLKLLTREWAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPAELEANP-GAALSRAYDMVLNGT-ELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDV 566
15 -86.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  15  15.AIHQLKVNGEDPYPHKKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFNKLRRGDIIGVQGNPGKTKK----------GELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYKMLVVGGIDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHEGQAYDVDFTPPFRRINMVEELEKICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFVMKK-EICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 508
16 -85.9005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  15  17.LINERRSKGINPYPHKKYNSLEKDVILNDIVQSVAGRVFSKRESGGKLIFYDLHGEGTRLQVLANARFHSGDEAFDRIKRGDIIGVNGYPARSKS----------GELSIIPYEIIQLTPCLHMLPHTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHLDMDLYLRVAPELYKMLVVGGIDRVYEIGRVFRNEGIDQ-THNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHENPVYEVDFTPPFRKVNIYDGLQELAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPL-AKWHRSIPGLTERFELFVVTK-EIVNAYTELNDPLTQRLRFDEQAKQKQA-ENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPD... 511
17 -85.3005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  16  24.MMECIKDAGRPFYPHKKYGNVENGYIDKDTTLSLSGRVTSIRSSSSKLIFYDIFCEEQKVQIIANIMEHDISVSHSEIRRGDVVGFTGFPGKSKR----------GELSLFSKSVVLLSPCYHMLPTAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHLETQLYMRIAPELYKQLIVGGLDKVYEIGKNFRNEGIDLT-HNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHEGKCIEIDFTTPWKRFSFVEEIESMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPL-AKWHREKPEMTERFELFVLGK-ELCNAYTELNEPLQQRKFFEQQADAKAS-ETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNV... 516
18 -84.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  2.............LRTHAAGSLRP--ADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREGDV--LAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPT-GQIEVNATELTVLGES-APLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD--------------LPLPLPRISYEEAMRRFGSDKPDLRFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVCNGN-EIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDP 563
19 -83.9005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  12.......GSHVFVLRSHAAGLLRE--GDAGQQVTLAGWVARRRDHGG-VIFIDLRDASGIAQVVFRDPQDTELAQAHRLRAEFCVSVAGVVEIRPEGNANPEIAT-GEIEVNATSLTVLGEC-APLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYR--------------IPTPIPRIGYAEAMRRFGTDKPDLRFGLELVERVEIANRLGLIDPDAWAFVWVVDPPAVHHAF-RIESDTGSVLADAYDIVCNGH-EIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDP 582
20 -83.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  22  2.AMGTLEAQTQGPGSMVLRTHAAGRPADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREGDV--LAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPT-GQIEVNATELTVLGES-APLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD--------------LPLPLPRISYEEAMRRFGSDKPDLRFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVCNGN-EIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDP 579
21 -83.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  22  1.............MRTEYCGQLRL--SHVGQQVTLCGWVNRRRDLGS-LIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRDMAT-GEIEVLASSLTIINRA-DVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFLPQSPQLFKQLMMSGFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGV--------------DLGDFPVMTFAEAERVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAP-ENAVANAYDMVINGY-EVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACL 563
22 -82.6004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  16  14.DVEEYQKAGHNPWPHKFNVSITEKSQVSDDIVSVAGRVLSKRSSSSALMFIDLHDSQTKLQIMLNKSAYENKEDFVSIYRGDICGFTGHPTRTK----------TGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKLVVGGINRVYEIGRLFRNEGIDQT-HNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGG--STKLEIKDRLMDINNEEDIKMLEKFFKKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSPL-AKYHRSEPELTERFELFILKR-EIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPE... 564
23 -82.1003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  18  15.KLKKIEELGVDPFGKRFERTHKEELEEQQIEVAVAGRIMTKRGMGK-AGFAHIQDVTGQIQIYVRQDDVGEYELFKISDLGDIVGVRGTMFKTKV----------GELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHKRLIVGGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQ---YGEHLVDLTPEWRRLHMVDAIKELAKEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPL-AKKNPDDPRFTDRFELFIVGR-EHANAFTELNDPIDQRQRFEEQLKEREQ-EDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
24 -81.8001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  18  57......................NQELESLNIEVSVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDSLPEGVQFKKWDLGDIIGARGTLFKTQT----------GELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVT---YGEHVFDFGKPFEKLTMREAIKKLAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGGR-EIGNGFSELNDAEDQAERFQEQVNAKAA-EDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQ... 503
25 -81.6004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  21  1....MIPEFSSFVVRTNTCGELRS--SHLGQEVTLCGWIQYRRQNT----FLVLRDFDGLVQVIIPQDESAASKILCEAPVESVVQVSGTVISRPAGQENPKMPT-GEIEIKVKTAELLNACKKPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKE-FLVPS-GKFYSLPQSPQQFKQLMVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDP--------------VVVPFPTMTFAEVLATYGTDKPDTRFGRLECADLLETRGVVLRDPTLFSFLWVVDFPSAHHPFHLLYTEPKKARSQHYDLVLNGN-EIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDL 574
26 -81.5004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  15  15.FIQDQKDKGINPYPHKKYKDLGNGEHLEDTILNITGRIMRVSASGQKLRFFDLVGDGEKIQVLANYSFHNHAECYDKIRRGDIVGIVGFPGKSKK----------GELSIFPKETILLSACLHMLPMKYG-LKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPKMLIVGGIDKVYEIGKVFRNEGIDNT-HNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNKNQPIEIDFTPPYPKVSIVEEIEKIIKEHKIELPNPPTAAKLLDQLASHFIENKNDKPFFIVEHPQIMSPL-AKYHRTKPGLTERLEMFICGK-EVLNAYTELNDPFKQKECFKLQQKDREK-SAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPA... 507
27 -81.1005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  16  20.KRARLLAEGYDPYPVAIERTHTPTDSATEDIVGVAGRVVFARNTGK-LCFATLQDGDGQLQAMISLDEVGRESLKADVDIGDVVYVHGTVISSRR----------GELSVLADSWRMAAKALRPLPVAHKE-MSEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSLDIDLYLRIAPELFKRCIVGGFDRVFELNRVFRNEGSDS-THSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTR--QLSMPDGSVYDIDGEWATMEMYSSLSIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPL-TRQHRSIPGVTEKWDLYVRGV-ELATGYSELNDPVVQRDRFADQARAAAA-EDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETVLFPIVRPH... 498
28 -80.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  57......................NEELEALNIEVAVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDDLPEGVQFKKWDLGDILGAKGKLFKTKT----------GELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVT---YGDVTLDFGKPFEKLTMREAIKKIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGGR-EIGNGFSELNDAEDQAQRFLDQVAAKDA-EDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 503
29 -80.9006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  16  23.KRADLLAQGRQPYPVDVPRTHTPVDARTGEIVGVTGRVVFARNSGK-LCFATLQEGDGQLQAMISLAEVGQEALKTYVDIGDIVFVHGEVITSKR----------GELSVLADSWQMAAKALRPLPVAHKE-MSEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSLDTELYLRIAPELFKRCLVGGFERVFELNRVFRNEGADS-THSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTR--QVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPL-TRSHRSIPGVTEKWDLYVRRI-ELATGYSELTDPIIQRERFEAQARAAAA-EDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETVLFPIVKPR... 502
30 -80.6004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  18  73......................KEALEAKSLEVAIAGRMMLKRVMGK-ASFATVQDGSGQIQFFVTPADVGAYDAFKKWDLGDIVAARGVLFRTNK----------GELSVKCTQLRLLAKALRPLPDKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYKRLIVGGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQ---YQGRELDLAQPFHRLTITQAIQKYAPSYTDGQFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPL-ARESDTVAGITERFELFITGR-EIANGFSELNDPEDQAARFKKQVEQKDA-ADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRE... 522
31 -80.3006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  15  83.AIHQLKVNGEDPYPHKKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFNKLRRGDIIGVQGNPGKTKK----------GELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYKMLVVGGIDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPGQAYDVDFTPPFRRINMVEELEKICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFVMKK-EICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
32 -65.4004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  3............................................................................................................................................DDGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDEKAVQVPVKAIPNASFEVVHSLAKWKRRTLAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKAEHLLLAYPNLTAKEREREIAREYGAVFGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMN-SLSSLKGLNGDILLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWPEEIRKKHN 349
33 -62.5003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  2...................................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLVPFETRFQGMNLWLMTSPEYHKRLLVAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEED--RDTLLQLLFTFGVEPNIGKPTFVYHFPASQASL-AQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFEQDNRKRAA-QNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFS........ 335
34 -62.40011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  10  5...................................................................................................................................................YIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHEGLYTHMKALRDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLA-PFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKRHDVRAPDYDDWSTPSELGHAGLNGD---ILVWNPVLEDAF-ELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP 327
35 -62.1003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  17  9...................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLFPFETRFQGINLYLMTSPEYHKRLLAAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ-----ESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSIADTEEDRDTLLQLLFTMGVEPHIGKPTFIYHFPASQASL-AQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFEQDNRKRAA-QNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFT........ 322
36 -36.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  3........................................................................SSSSGLVPRGSHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKSTIGEDHPLFSQVFDGKKCLRLAPNLYTERLWDKPIRIFEIGTCYRKESQGA-QHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA--ELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGRLLMIREGTQHVQSMARSLSYLDGVR.......................................................................................................... 298
37 -30.3004gla_C mol:protein length:109 OBody NL8  ali model follow..  17  2.........SVYPKKTHWTAEITP--NLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVPVYLEADHLFKVFAELSREDVVVIKGIVEASK--------GVGRGVEIFPSEIWILNKAKA............................................................................................................................................................................................................................................................................................................................................ 109
38 -30.0004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  18  1.........AVYPKKTHWTAEITP--NLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEASEQYG------SATGVEIFPSEIWILNKA.............................................................................................................................................................................................................................................................................................................................................. 108
39 -29.9004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  17  3........GSVYPKKTHWTAEITP--NLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVSVYLEYGKTFKVFAELSREDVVVIKGIVEASKAAAD-----MHNGVEIFPSEIWILNKAK............................................................................................................................................................................................................................................................................................................................................. 113
40 -29.2005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  6.............MRSHFCTEISE--KDVGKIVKVAGWCNTYRDHGG-VVFIDLRDKSGLVQLVCDPSS-KAYEKALEVRSEFVLVAKGKVRLRGAGLENPKL-KTGKIEIVLEELIIENKS.............................................................................................................................................................................................................................................................................................................................................. 109
41 -28.8004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  18  5..............KTHWTAEITP--NLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEATTVTR------WDTGVEIFPSEIWILNKA.............................................................................................................................................................................................................................................................................................................................................. 107
42 -28.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  5..............KTHWTAEITP--NLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERDHLFKVFAELSREDVVVIKGIVEAGWPVA------LDTGVEIFPSEIWILNKAKP............................................................................................................................................................................................................................................................................................................................................ 109
43 -23.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  7............................................................................GLVPRGSHMASAPALTKSQ----------TDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLKLDRALPDPIKIFEIGPCYRKESDGKE-HLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDS-----------------CMVYGDTLDVMHG-------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
44 -23.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  7............................................................................GLVPRGSHMASAPALTKSQ----------TDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLYNYLRKLDKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGRENLESIITDFLNHLIDFKIVGDSCMV------------------YGDTLDVMHG-------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDK---------------PWIGAGFGLERLLKVKHDFKNIKRA............ 271
45 -22.3004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  11  3........................................................................SSSSGLVPRGSHMASAPALTKSQ----------TDRLEVLLNPKDEISLN---SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLGLPDPIKIFEIGPCYRKESDGK-EHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWG---------------------IDKPWIGAGFGLERLLK-VKHDFKNIKRAARSESYYNGIS.............................................................................. 282
46 -21.6005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  14  3.............................................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYNYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLYLPDPIKIFEIGPCYRKESDGKE-HLEEFTMLAFAQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSC-------------MVYGDTLDVMHG-------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 254
47 -20.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  12  13....................................................................................................................VLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDRAKIFEIGPCYRKESDGKE-HLEEFTMLNFFQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSCS-------------VYGDTLDVMHG-------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 253
48 -18.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  3.......................................................................................GGLVPRGSHGASAPALTKSQTDRLE----VLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKKIFEIGPCYRKESDGK-EHLEEFTMLVFWQMGSGRENLESIITDFLNHL......................................................................................................................................................................................... 198
49 -16.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  51........................................................................................................................................................EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKKIFEIGPCYRKESDG-KEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL..................................................................................................................................................................................... 184
50 -12.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  50...............................................................................................................................................................TRTVEEIEDLFLGLGYEIVDGYEVEQDKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNKIICPGKVYRRDSDDAT-HSHQFTQIEGLVV-IKMSDLKGTLELVAKKLFGADR----------------------EIRLRPSY-----------------------------------------FPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGM------VHPNVLEMAGFDSNEYSGF------------AFGMGPDRIAMLKYGIEDIRYF............ 269
51 -12.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  12  4.............................................................EALAAIQNARDLEELKALKA-RYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASGGLHPITLMERELVEIFRALGYQAVEGPEVESEPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTRIVVPGRVFRFEQTDAT-HEAVFHQLEGLVV-IAMAHLKGAIYELAQAL------------------------------------------------------------------------FGPDSKVRFQPVYF------PFVEPGAQFAVGKWLELGGAGM--------PKVFQAVDAYRERLGLPPAYRGVTG----AFGLGVERLAMLRYGIPDIRYF............ 335
52 -12.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  9.......................................................................RRQMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP------------DESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLKDQGGEL-LSLRYDLTVPFARYLAMKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSLLDGMFAICGVSDSKFRTICSSVDK-LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKL--DLSLARGLDYYTGVIYEVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 404
53 -12.2003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  11  37...........................................................................................................................................................MRCRRHLFDVFHATAKTFGFEEYDAPVLESEELEITEQMFNFITKGGHR-VALRPEMTPSLARLLLGKWYSIPQCWRYEAITRGRR-REHYQWNMDIVGVK--ELVCAACWAMRSLLQTVVEQAGVTSDKFAPVCVIVDK-MEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDDASVVRGLAYYTGIVFELCGGG----RYDNLLTTYGSPT----------------PIPCAGFGFGDCVIVELLQEKRLLPDI............ 352
54 -11.9002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4.....................................................................................................................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYLTLRPEGTAGCVRAGIERLWYIGPMFRHERPQKGRY-RQFHQLGCEVFGLQ--ELIMLTARWWRALLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYT---------NQRLVRGLDYYNRTVFEWVTNSLGSQGT-----------CAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLV..................... 323
55 -11.8004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  13  1.....................................................MENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQRIVCPGRVYRCDSDLT--HSPMFHQVEGLLV-VSFADLKGTIEEFLRAFFEK----------QLEVRFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQ-----------------------------------------------------TGWLEVMGCGM------VHPNVLRMSNIDPEKFQGF------------AFGMGAERLAMLRYGVNDLRLF............ 326
56 -11.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  20...........................................................................................................................................................TAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYLTLRPEGTAGCVRALVERVWYMGPMFRYEKPQKGRY-RQFHQFGVETFGVA--ELIMLTARLWKRMTDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFV---------NQKLVRGLDYYNKTVFEVCAGG----RYDGLVGQLKGKADQS--------------VPAVGFAMGMERLLLLLEQVEQAEI............. 330
57 -11.8003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  11  1..................................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPVLQAKGNQGDNIIYGLEPILPPN-RALKFDQTVPLAAYIARARYQMDVVFRGERAKDGRF-RQFRQCDIDV--VGREKLSLLYDAQMPAIITEIFEAVNIGDFVI------------RINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFNYYTGTVRYEKMPGVGISIGLTRLISRLLKAGILNTL............ 367
58 -11.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  11  37...........................................................................................................................................................MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELEITEQMFNFITKGGHR-VALRPEMTPSLARQLLAKWYSIPQCWRYEAITRGRR-REHYQWNMDIIGVK--ELVCAACTAMQSILQTVVEQAGVSADKFAPVCVIVDK-MEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDDASVVRGLAYYTGIVFELCGGG----RYDNLLTTYGSPT----------------AVPCVGFGFGDCVIVELLNEKKLLPE............. 351
59 -11.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  11  3......................................................................................................................MGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYLTLRPENTAAVVRAAIERLWYIGPMFRHERPQRGRY-RQFHQVGVEALGFA--EIVMMCQRLWEDLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFT---------NPRLVRGLDYYNLTVFEVAAGGR---------------------YDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE............. 345
60 -11.7001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  10  16...........................................................................................................................................................SKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYITLRPEGTAAVVRSYIEKLYYNGPMFRYERKQKGRY-RQFNQFGVEAIGAE--EVLAMVMHIYQSFMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYT---------DPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCG--------GRYNGLLELLDGPSETGIGFALSIERLLLAL..................... 317
61 -11.7004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  4...................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLKDQGGEL-LSLRYDLTVPFARYLAMKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSLLDGMFAICGVSDSKFRTICSSVDK-LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKL--DLSLARGLDYYTGVIYEVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 351
62 -11.6001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  20  7GPSATQSQAGGFQGPNGSVTTVESAKSLDDTWVTLRGNIVERISDDL----YVFKDASGTINVDIDHKRWNG----VTVTPKDTVEIQGEV-----------DKDWNSVEIDVKQIRKVNP............................................................................................................................................................................................................................................................................................................................................... 109
63 -11.6003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  14  7....................................................LVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRI----ESFFGELGFTVATGPEIEDDGHHPARADHDTFWFDTTRLLRTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQT-HTPMFHQMEGLIV-ISFTNLKGTLHDFLRNFFEEDLQ--------------------------------------------------------------------IRFRPSYFPF------TEPSAEVDVMGKNGKWLEVLGCGM---------NVLRNVGIDPEVYSGF------------AFGMGMERLTMLRYGVTDLRSF............ 315
64 -11.4004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  13  2..........................................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFLTLRPEGTAAMVRAYLERLWMAGPMFRAERPQKGRY-RQFHQVNYEALGSE--EAVVLLYECLKEL----LRRLKVKLSSVGDPEDRARYNAYLREVSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVER-EPALVRGLDYYVRTAFELGGGGR---------------------YDGLSELLGGPRVPGVGFAFGVERVALAL..................... 318
65 -11.2004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  10  2......KKAGNNTLRPVTIRQILNAEQPHPDALTFVAVVRNISRNATNVAY-SVEDGTGQIEVRQLDSSSDDSSKASEIRNNVYVRVLGTLKSFQNRR-----------SISSGHMRPVID............................................................................................................................................................................................................................................................................................................................................... 116
66 -10.9001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  10  20...........................................................................................................................................................MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLELLQQTYSFVDKGGRE-VTLIPEATPSTVRMVTSRWYSFPKVWRYEEPQAGRY-REHYQFNADIFGSD--EVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITLASYGVKNVRYDFSIVRGLSYYTGIVFEILGGGR---------------------YDNLASLMSGESVPAVGFGMGDAVISLLL..................... 321
67 -10.8006FTT Entity 1(prereleased)  ali follow..  15...........................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGGR---FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
68 -10.8005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15...........................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGGR---FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
69 -10.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  10  48..............................RWIQIVGYIAAIDIYEGKHVL-TVDDCSGMVLRVVIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEV-----------ELIAQSFEELRDPNDEW.......................................................................................................................................................................................................................................................................................................................................... 133
70 -10.5002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  10  39......SRARAQHIVPCTISQLLSATLVDESQVTIVGIIRHAEKAPTNIVY-KIDDMTAAPMDVRWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKK-----------SLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQ-----DLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDD------HFKSTDAE............................................................................................................................................................................................................. 270
71 -10.1001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  30...........................................................................................................................................................VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFITLRYDFTLPLVRLYSQRYSYFGKIFRKEKRHKGRS-TENYQIGIELADKSELEILSLALQVIEQLFQRLCQLADGSTELLKKDLSGLNAFIEKNNFSKELRGLRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYT------------FKAYSSAANQPILSGGRYDQL----------------------LSNFQEEFAIGFCCHMDTILKALERQELEED............. 336
72 -9.9703rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  37...........................................................................................................................................................AKRRRAVETRLLSFVEDAGYEPVTSGLFEARSPESSRDWIRLFDGGGDA-VALRPEMTPSIARMAAPRWCYCERVYRRTDDPASLKAAESTQVGIERSVDVDMDVLRLLHEASAAAVPRLLDALGISASLSRAFLACLTSG-NYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDA-DLALHREFEMFAPGVGAPIAQGGRYDEL----------------------LAQFGAGPAVGFAFEVERVMAVLEAQEEGEGEC........... 373
73 -9.8903l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  110...................................NKWIRVDK--SAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQF----RQIFLEMGFTEMPTDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSKYFSIDRVFRNETLDAT-HLAEFHQIEGVVA-LTLGHLMGVLREFFTKLGIT--------------------------------------------------------------------------QLRFKPAYNPYTEPSME----VFSYHQGLKEVGNSGV------FRPEMLLPMGLPENVSVI-------------AWGLSLERPTMIKYGINNIREL............ 477
74 -9.8703od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  24...........................................................................................................................................................YKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVQLFKLLDQQGNT-LVLRPDMTAPIARLVASRLAYQSNVYRAQQNEGGKP-AEFEQLGVELTASADGEVIALMIAALKRA-VGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYT------------FEGYGNRLGVPLCSGGRYDEL----------------------LSKFHRPQATGFGVRIDLLVEAL..................... 327
75 -9.6003kf8_A mol:protein length:220 Protein stn1  ali model follow..  86..............................NQINIFGKIVYEQGVEESYVILVISDFIGIDSKIRQEQFKEVGLTLDKKNYGKIVELEGEIYNWY-----------DSINVSKKPDRELKVSKITVLSHRPDGLHFEFEQWKKRMEFRKNNLVEPWVFIPTPQR.................................................................................................................................................................................................................................................................................................... 219

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.