current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3mey_A mol:protein length:346 Bll0957 protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWRLast
1 -111.0003mey_A mol:protein length:346 Bll0957 protein  ali model  100  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR 340
2 -110.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  97  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR 340
3 -75.4003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  20  155VIRLVAWAVEERSELVERVTKSGPRRIRFRGDVTEEARRRGWVEFPGRGQWIYTPPMAALFEVLRDFLLETRKLGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVCPPKRDPELFDDFKRELYTLGSLKEKLRDPGYVLAPAQCEPFYELLRDEVVDPER-KLYDCSGWTYRWEGGKGLERVNEFQRIEHVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDPFYLEGRLLDRDIELPDVPSYEFEVYLPFKGERISVGSFNVHGEHFVDGFNVKEKSGRTLFTGCAGLGVTRWVVGLLAQHGFYPYEWPEPILERID............... 510
4 -74.2002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  166LEEKIEAAQYGAKAEHWNLLQREPMEHPFKEDPTQAMMKEGWLRGSSRGQWIHGPQSARIFRTFEKIVLELEPLGYREMIFPKLVTWEVWMKSGHAKGVPEIYYVCPPQTRDPDYWEEVADYYKVTHEIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEE-KVFDRSGTSHRYESGHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPKGIR........ 514
5 -46.1002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  16  105IPNLPHPSVPVGEDEKDNVEDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC---------------------------ERDNLYLIPTAEVPLTNLYREEILKEENPIYLTAYTPCYRREDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELC----------TGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSRFVHTNGSGLAVGRTLAAILENYQDGSVVVPEVLRDYVGTDVIRPE........ 425
6 -45.5003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  135IGNLLHPSVPISNDEDVDNKVEKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVI----------------GKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDPIKYAGLSTCFRQEDTRGIFRVHQFEKIEQFVYSSPNKSWEMFEEMITTAEEFYQSLGIPYHIVNIV----------SGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTEFVHMNATMCATTRTICAILENYQTKGITVPEKLKEFMPPGLQE.......... 466
7 -45.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  13  108VGNIVHESVVDSQDEENNELVRAKLSHHEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVID-------------------------GEDEKYLIATSEQPISAYHAGEWFEEQLPVRYAGYSSCFRREAGWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIV----------SGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCQEKKYVHCNSTLSATERTICCILENYKEDGLVIPEVLRKYIPGEPEFIP........ 443
8 -45.0002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  15  106LPNITHPSVPVGKDENDNVPEWKPKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV---------------------------EDEDLYLIPTAEHPLAGMHANEILDGKDPLLYVGVSPCFRKEDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIPYRVVNIC----------TGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRRYVHTNSTAIATSRAIVAILENHQDGTVRIPKVLWKYTGFKEIVPVEKKER... 451
9 -44.9001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  12  101VPLPPWPGAPVGGEEANREIKRFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI---------------------------AETDLYLTGTAEVVLNALHSGEILPYEAPLRYAGYAPAFRSEDVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELPYRLVEVA----------TGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPRYAYTNNTALATPRILAMLLENHQDGRVRVPQALIPYMGKEVLEPCG....... 421
10 -44.7003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  13  210VPLPPWPGAPVGGEEANREIKRVGGPPEFSFPPLDHWWEPRISQVSGSRSYALKGDLALYELALLRFAMDMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI---------------------------AETDLYLTGTAEVVLNALHSGEILPYEAPLRYAGYAPAFRSEDVRGLMRVHQFHKVEQYVLTEASLSDRAFQELLENAEEILRLLELPYRLVEVA----------TGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPRYAYTNNTALATPRILAMLLENHQDGRVRVPQALIPYMGKEVLEPGA....... 530
11 -44.5001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  15  147LPNQTHPDVPVGDESQARVLHVQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNI-----------------------DPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDPIRMVCSSTCYRAEEPWGLYRVHHFTKVEMFGVTGPEQSSELLEEFLSLQMEILTELGLHFRVLDMP----------TQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEQFAHTNATGCAVPRLLIALLESYQDGSVLVPPALQPYLGTDRITTPTHVP.... 474
12 -43.1003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  12  141VGNILHESVPIAQDEETGNTRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVS-------------------------GDGDKKYLIATSEMPIAAYHRGRWFTELKPLKYAGMSTCFRKEDTLGIFRVHQFDKIEQFVVCSQEESWRHLEDMITTSEEFNKSLGLPYRVVNIC----------SGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNEYCHMNGTLCAITRTMCCICENYQTEGVVIPDVLRPYMMGIEMIRFEN...... 471
13 -42.2006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  13  144IGNIVHETVVVSDNEDNNGIGYKCLKHIDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYAIDLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVTG-------------------------EGEDKYLIATSEQPIAAFHLEKRFDESEPIKYCGMSTCFRKEDTLGIFRVHQFEKIEQFVVTSPKDSWEMFDEMIGNSEAFYQSLGIPYRVVNIV----------SGALNNAAAKKFDLEAWFPGGNEYRELVSCSNCTDYQTRRLEVKYGEVEFCHMNSTLTATSRTLCCIVENYQTEGVNVPEVLQPYMGGTKFIKFKN...... 479
14 -31.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  2GSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKR------------------------ELLYGPTNEEMITEIFRAYIKSKSLPLNLYHIQWKFRDEPRFGVMRGREFLMKDAYSFDVDEAARKSYNKMFVAYLRTFARMGLKAIPMRASHEFIVLAETGESGVYIDRDVLNLPVPDENVNTRGIEVGQIFYFGTKYSDSMKANVTGPDPIHGGSYGVGVSRLLGAIIEACHDDNGIWPEAVAPF................. 360
15 -30.2005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  1................GAMGIAAKREENFSAWYIDVITKAEMIYYDVSGCYIIRPWAYYVWKCVQRFLGGIEKLGVEDCYFPMFVSRSCLREKDHIEGFAPEVAWVTRAGDTELE--------------------QPVAVRPTSETVMYPYYAKWIRSRDLPVRLNMWNNVIRWEHPTPFIRTREFLWQEHCAWAKAEECAKEVLEILECYASVYEQLL-------AVPVVRGRKTEKEKFAGGDYTTTVETF--IEAVGRGCQGATSHNLGQNFGKMFDIRFQDPETLIPWQNSWGLTRVIGVMIMVHGDNRGVMPPRVAST................. 291
16 -29.7004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  11  3................SNILGITSKKIENFSDWYTQVIVKSELYYDISGCYILRPAAYYIWECVQAFFKEIKKLNVENSYFPLFVTKNKLKEKNHIEGFSPEVAWVTKYGDSNLP--------------------EEIAIRPTSETIMYSVFPKWIRSRDLPLKLNQWNTVVRWEQPTPFIRTREFLWQEHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGI---------KSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENYVHQTSWGCT-TRSIGIMIMTHGDDKGVLPPNVSKY................. 292
17 -29.2004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  14  5.........EGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMYHDISGCYILRPWAYAIWEAIKDFFAEIKKLGVENCYFPMFVSQSALEKEKHVADFAPEVAWVTRSGKTELA--------------------EPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEHPQPFLRTREFLWQEHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGR---------KTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDGEKQFAYQNSWGLTRTIGVMTMVHGDNMGVLPPRVACV................. 303
18 -29.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  15  1MGSSSSGLVPRGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEHDISGCYILRPWAYAIWEAIKDFFAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTEL-------------------AEPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEHPQPFLRTREFLWQEHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGR---------KTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDGEKQFAYQNSWGLTRTIGVMTMVHGDNMGVLPPRVACV................. 319
19 -28.9005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  14  2...........ASKENESLLGITADKITSFADWYSQVIVKSEMYYDISGCYILRPWSYFIWETIQSVFDQIKQHDVQNAYFPIFVTQKKLTEKDHVEGFSPEVAWVTKSGKSDLA--------------------EPIAIRPTSETIMYPYFAKWIRSRDLPLKINQWTSIVRWEHPTPFIRTREFLWQEHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGT---------KSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKYAHQTSWGLT-TRAIGVMIMTHGDNKGVLPPKVAPV................. 296
20 -28.8005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  13  6......................TAKKSTNFADWYTQVIVRGELYYDISGCYIIRPWAYRIWEAVQKFFDDIKRLGVENCYFPMFVSQAKLKEKDHVEGFKPEVAWVTHYGDSELP--------------------EKVAIRPTSETIMYPAYAKWIRSRDLPLKLNQWNNVVRWEQPTPFLRTREFLWQEHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGE---------KSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKLVHQTSWGCTT-RSLGVMIMTHGDDKGVLPPRVVAV................. 289
21 -28.6005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  18..................................QAIVRSEMIYYDISGCYIMRPWAFHIWEKVQRFFDEIKKMGVENSYFPMFVSRHKLKEKDHVEGFSPEVAWVTHYGDSPLP--------------------EKIAIRPTSETIMYPAYAKWIRSRDLPLKLNQWCSVVRWEQPTPFLRTREFLWQEHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGE---------KSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEELVHQTSWGCTT-RSLGVMIMTHGDDKGVIPPRVASV................. 288
22 -28.5001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  15  2................AKEKGLTPQSQDFSEWYLEVIQKAELADGPVRGTIVVRPYGYAIWENIQQVLDRFKETGHQNAYFPLFIPMSFLKEAEHVEGFSPELAVVTHAGGEELE--------------------EPLAVRPTSETVIGYMWSKWIRSRDLPQLLNQWGNVVRWEMRRPFLRTSEFLWQEGTAHATREEAEEEVRRMLSIYARLAREYAAIPVIE-------GLKTEKEKFAGAVYTTTIEALM---KDGKALQAGTSHYLGENFARAFDIKFQDRDYVHTTSWGL-SWRFIGAIIMTHGDDRGVLPPRLAPI................. 288
23 -28.2001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  14  13.....SHMQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDRDHEEVLFPLLVPEDELKEAIHVKGFEDEVYWVTHGGLSKLQ--------------------RKLALRPTSETVMYPMFALWVRSTDLPMRFYQVVNTFRYETKHTIRVREITTFKEATIHATASEAEEQVERAVEIYKEFFNSLGIPY--------LITRRPPWDKFPGSEYTVAFDTLMP---DGKTLQIGTVHNLGQTFARTFEIKFETPEYVHQTCYGL-SDRVIASVIAIHGDESGCLPPDVAAH................. 309
24 -27.8002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  2..........KQSKMLIPTLREVPNDAEVLSHQI--LLRAGYIRQVAAGIYSYLPLANRVLEKLKTIMEEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD-------------------------NDRDYILGPTHEETFTELIRDEINSKRLPLNLYQIQTKYRDESRSGLLRGREFIMKDGYSFADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGSKEFMAISEIGEDTICYSTESDYAANLEMATSTKGIEIGHIFKLGTRYSDAMGATVLDENSVIMGCYGIGVSRLLSAIVEQNADERGNWPTGIAPF................. 471
25 -27.8003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  2..........AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEYAKVGISQILFPTVIPESFLKESDHIKGFEAECFWVEKGGLQPLE--------------------ERLALRPTSETAIYSMFSKWVRSKDLPLKIHQTCTIFRHENTKPLIRVREIHWNEACCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQK----------LRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKAHPYLTCAGIS-TRVLACALSIHGDSGGVLPPLIAPI................. 294
26 -26.7005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  14  1.......MAMRTSQYLLSTLKETPADAVVISHQL--LLRAGMIRRLASGLYTWLPMGLRVLRKVETIVREMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKD-------------------------HEREFCVGPTHEEVITDLARNELNSKQLPINFYQIQTKFRDEPRFGLMRGREFIMKDAYSFLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQASHEFHVLANSGEDDIVFSDSSDYAANIEKAEAKRGIEVGHIFQLGTKYSEAMKLSVLSEQNLIMGCYGIGVSRVVAAAIEQNHDERGLWPSALAPF................. 474
27 -25.9001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  13  2.....................SHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIINLLDESGHDEALFPMLIPEDLLAKEAHIKGFEDEVYWVTHGGKTQLD--------------------VKLALRPTSETPIYYMMKLWVKVTDLPIKIYQIVNTFRYEHTRPLIRLREIMTFKHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDT-----------IFPDGRTMQIATVHNLGQNFSKTFEIIFETPTYAYQTCYGISD-RVIASIIAIHGDEKGILPPIVAPI................. 283
28 -24.6004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  3LTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEER---ENYLGKLEREITRFFVDR---GFLEIKSPILIPLEYIERMG----------------DNDTELSKQIFRVDK-----------NFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESD-GKEHLEEFTMLNFFQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCSVYGD--------------------TLDVMHGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKVKHDF---------KNIKRAARSE............. 257
29 -23.4004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  1..................MGSSSSGDHRKIGRDQELYF----FHELSPGSCFFLPKGAYIYNALIEFIRSYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-------------------------EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPFLGDIEVWDQAEKQLENSKIDIQIK-DAIGRYHQCATIQL---QLPIRFNLTYVSHDIVHRAILG-SVERMIAILTENYGGKWPFWLSPRQVMV................ 309
30 -23.3003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  1MGSSSSGLVPRGSHMASATKNASSATPATMTSMVSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKE----------------------EYGLKPMNCPGHCLIFGKKDRSNELPLRFSDFSPLHRNEASSGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFINFSTRPDHFIGDLKVWNHAEQVLKEIKLDIMVT-DHLRKTHQVATIQL---QLPERFDLKFKDQDMIHRATFG-SIERFMALLIDSNEGRWPFWLNPYQAVI................ 344
31 -23.1004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  17..........................................FHELSPGSCFFLPKGAYIYNALIEFIRSYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-------------------------EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPFLGDIEVWDQAEKQLENSKIDIQIK-DAIGRYHQCATIQL---QLPIRFNLTYVSHDIVHRAILG-SVERMIAILTENYGGKWPFWLSPRQVMV................ 305
32 -22.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  13  4LTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEER---ENYLGKLEREITRFFVDR---GFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLAFAQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM--------------------HGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKVKHD----------KNIKRAARSE............. 258
33 -22.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  14HMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLSFIQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCMVYGD--------------------TLDVMHGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKV.................................... 261
34 -22.6003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  11  7.........KTHIDYAYELDITVKPDSRVPVFNREFA------TFTGAGVPLFSLGGGPIRYALAEVLAKHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLF-------------------------DIEGHEFAVKPMNCPYHILLFLNEVAKLPLPFKVFEFGRVHRYEPSYGLLRVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLFKTFKVRLSMKEFMGSKEEWEGAEEALREAKLDFIMMVEESSKEWQMGTIQF---NLPRRFRLYDVVREIIHRALLG-SIERFLGVYLEHRRGRMPFTLAPIQFAV................ 343
35 -22.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  14HMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVYGDT--------------------LDVMHGDLELSSAVVGPIPLDREWGIDKP------WIGAGFGLERLLKVKHDFKNIKR........................... 270
36 -22.2004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  17..........................................MQEEAPGMVFWHNDGWTIFRELEVFVRSLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT-------------------------SSENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFVVKLSTRPEKRIGSDEMWDRAEADLAVAKIEFTLY-DCLDRAWQCGTVQL---SLPSRLSASYVGEDMIHRAILG-SMERFIGILTEEFAGFFPTWLAPVQVVI................ 305
37 -21.8004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  1....MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG---------------IDNDTELSKQIFRVDK-----------NFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVFGDT--------------------LDVMHGDLELSSAVVGPIPLDREWGIDKP---------AGFGLERLLKV.................................... 244
38 -21.6002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  17  78...................................................LRTVKHRPALLELEEKLAKLHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQV--------------------------FWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKE-SQGAQHLNEFTMLNLTELG--TPLEERHQRLEDMARWVLEAAGIEFELVTESSVVYGDT--------------------VDVMKGDLELASGAMGPHFLDEKWEIFDP---------LGFGLERLLMIREGTQHVQSMARSLSYLDG................. 296
39 -21.4001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  12  214LQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVDKVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPMQLDET-----------------------ESMVLRPMNCPHHMMIYANKPHSRELPIRIAELGTMHRYEASSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGLSYRDPEDKEKYFDDDDMWNKAENMLKEAKLDVQVK-TAMGKEETLSTAQL---LLPERFDLTYIGQDVIHRGVVS-TMERFVAFLTEETKGAFPTWPKQVDLHYDYARQLQDELKSQGVR 575
40 -21.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  17....SAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDL-IYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLNFCQMGSG----CTRENLESIITDFLNHLGIDFKIVGDSCMVFGDT--------------------LDVMHGDLELSSAVVGPRPLDREWGIDKP------WIGAGFGLERLLKVKHDFKNIK............................ 269
41 -20.8001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  15  2....................ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRYERDDMEGLDASVLTHRLVLHYSGHEATFADPM--VDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAP........ 335
42 -20.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  17......ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG---------------IDNDTELSKQIFRVDK-----------NFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLVFWQMGSGCT----RENLESIITDFLNHLGIDFKIVGDSCMVFGDT--------------------LDVMHGDLELSSALVGPIPLDREWGIDKP---------AGFGLERLLKVK................................... 259
43 -19.8001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  218IYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYH----MQEEAPGMVFWHNDGWTIFRELEVFVRSLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTS-------------------------SENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEVKLSTRPEKRIGSDEMWDRAEADLAVAKIEFTLY-DCLDRAWQCGTVQL---SLPSRLSASYVGEDMIHRAILG-SMERFIGILTEEFAGFFPTWPVQVVSQSEYVNELTQKLSNAGIR 568
44 -17.2001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  15  2....................ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKMMQAPERAGGAMTAAGVLDPASGEPGAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVISAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAP........ 398
45 -13.6002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  6................SGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQD--------YYNFEALNLPKSHPARDMQD--------------SFYITDEILMRTHTSPVQARTMEKRN---GQGPVKIICPGKVYRRDS--DATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGA-DREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNV-----KHTGWIEILGAGMVHPNVLEMAGF---DSNEYSGFAFGMGPDRIAMLKYG----------EDIRYFYTND............. 273
46 -13.6005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  12  4SMKLKHKRDDKMRFDIKKVLELAEKDFETAWRETRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQ--VGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDSTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVVVGEDVSV----DDGKVVAEGLLAQFGFKFKPDEKKSKYYTP------------ETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVP--------NLGLGVERLAMIIYG----------EDVRAMVYPQ............. 358
47 -13.6003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  156RSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETL-DATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGIT---QLRFKPAYNPY--------------TEPSMEVFSYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAW----GLSLERPTMIKYG----------NNIRELVGHKVNLQMVYDSPLCR 494
48 -13.4001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  32LTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKAERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESE--------FFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRT----HTSPMQVRYMVAHTPPFRIVVPGRVFRFEQT-DATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGP-DSKVRFQPVYFPF--------------VEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYREAYRGVTGFAFGLGVERLAML-IRYFFGGRLKFLEQFKGVL................ 350
49 -12.0002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  12  37VDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFIYGGVSGLYDFGPVGCALKNNIIQTWRQIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELYLRPETAQGIFLNFKREFNQGKLPFAAAQIGNSFRNEPRSGLIRVREFTMAEIHFVDPSEKDHPKFQNVADLHLYLYSA-TVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDGEFTIETEGKTFQLTKVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREG--DEQRTFFSFPAVVAP........ 559
50 -11.9004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  15  1..................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRYGYQNIRTPIVEHTPLFTR---------------GIGEVTDIVEKEM-------SFVDALNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQR--RYRQFHQVGVEALGFAGPDADA--EIVMMCQRLWEDLGLTGIKLEINSKYLEQYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEDYYNLTFEWVTDKGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLR 372
51 -11.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  16...............................................SGFPEFLPSEKRLELYLLDTIRRYESYGFTPIETPAVERLEVLQAK--GNQGDNIIYGLEPILPPNRQAEKDKSGDTGSE---------ARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKD--RFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINN............................................................................................................... 186
52 -11.3002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  11  2............KFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLSSSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFE-NFRFRKDEKRSKYYIPDTQTEVFAFHPKLV-----SSTKYSDGWIEIATFGIYSPTALAEYDIPYP--------NLGLGVERLA---MILYGYD------DVRKMVYPQ............. 350
53 -10.9005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  10...............................................KGFNDVLPTQTAAWRRLEQHLASLMDYGYQQIRLPIVEQTGLFKR---------------AIGDATDIVEKEMYTFFDKGN-----PPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQK--RYRQFHQFGVETFGVATPDIDA--ELIMLTARLWKRMGVDHMVQLELNTL---TTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQDYYNKTFEWTTTALGSQGTVCAGMGMER-LLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLR 356
54 -10.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  16...............................................RGMNDYLPGETAIWQRIEGTLKNVLGYGYSEIRLPIVEQTPLFKR----------------------AIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQK--RYRQFHQLGCEVFGLQGPDIDA--ELIMLTARWWRALGISEHVTLELNSI---YTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFADYYNRTFEWVTNSGRATPAVGFAMGLERLVLLV................................... 323
55 -10.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  10  13.......................................................KAIDIQTKILDYMTKFTDRGFKWLLPIMLSPI------------------TDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFV--------------LSPNIRLESRRK-RHSYEFTQLDFIEGAKMKDVMRLIEELIYGLKDILEEFGSDEKASMMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEEKIVAKIRAAARAGKLKPSAGAGIGVERLVRFIVGAKH-EVQPFPR...................... 286
56 -10.8002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  10  29.........SHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFA-------MSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAP........ 363
57 -10.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  4........................GTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHAAKTFGFEEYDAPVLESEELYIRK---EEITEQMFNFITKGGH------------------------RVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITR--RRREHYQWNMDIVGVKSVSAEV--ELVCAACWAMRSLGLS....................................................................................................................... 173
58 -10.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  1.....................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSVEDAGYEPVTSGLFEYVDTLLR-ARSPESSRDWIRLFDGGGDA------------------------VALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPASLKAAESTQVGIERIGEEASVDVDMD-VLRLLHEASAAAGVR....................................................................................................................... 180
59 -10.6005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  33LTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLE-SRDSLLSGCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVFDNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIE--ELLHMYPGNVSKLHGRDGRKNVVCVLSVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAP........ 380
60 -10.5004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11  15.......................................................QILTVKRSFSEALEK--ELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEV--------------------------VHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPETIQFVHAEHLLLGLNGDILLYNPTLDDSLEVSSMGIRVNAEA-EWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGCSVWPEEIRK.................. 346
61 -10.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  4........................GTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSARKFGFEEYDSPVLESEELYIR-KAGEEITEQMFNFITKGGH------------------------RVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITR--RRREHYQWNMDIIGVKSVSSEV--ELVCAACTAMQSLGLS....................................................................................................................... 173
62 -10.3004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  11  42MKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDD--------YHNFEALNIPGHHPARAMHDT---------------YFNANMLLRTHTS-----PVQVRTMESQQPPIRIVCPGRVYRCDSDL--THSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEK-QLEVRFRPSFFPF----TEPSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNI---DPEKFQGFAFGMGAERLAMLRYG----------NDLRLFFDND............. 330
63 -10.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  10  12......................................................SPTLDIQTKILEYMTDFVKEGFKWLLPVIISPIT------------------DPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFV--------------LSPNIRLESRQK-RHAYEFTQLDFVERAKMEDIMRLIERLVYGLSEVLEEFGSDEKASQMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEEKIVAKIRKAGLNEDSFRSAGAGIGVERLVRFIVGAKH-EVQPFPR...................... 286
64 -10.0004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  17....GGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIETLWLLHMYPGNVSKLHGRDGRKNVVCVLSVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAP........ 356
65 -9.6701qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  1..........................................MIKIPRGTQDILPEDSKKWRYIENQLDELMTYNYKEIRTPIFESTDLFAR----------------------GVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNQPIKLYYNGPMFRYERKQK--RYRQFNQFGVEAIGAENPSVDA--EVLAMVMHIYQSFGLKHLKLVINS--YTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLD-----GPSETGIGFALSIERLLLAL................................... 317
66 -9.6204g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  30......RGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRFKRHGAEVIDTPVFELKETLMG---------------KYGEDSKLIYDLKDQ-----------GGELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDPAMTRGRYREFYQCDFDIAGNFDPMIPDAE-CLKIMCEILSSLQIGDFLVKVND............................................................................................................... 224
67 -9.53011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  12........................................................ISFVKSHFSRQLEE--RLGLIEVQAPILSRVG------------------------DGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGL-YTHMKALRPDEDRLSPLHSVYVDQWDWRVMGDGERQFSTLKSTVEAIWAGIKA--FGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELTIGGGIGQSRLTMLLLQLPHIGQVQWPAAVRESV................ 326
68 -9.5203od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  1..................................SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEINLWGYDMIETPTLEYYETVGVVS--AILDQQLFKLLDQQGNT------------------------LVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEG--KPAEFEQLGVELIGDGTASADG--EVIALMIAALKRAGLS....................................................................................................................... 159
69 -9.5204rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  9...............................................RGTKDLFGKELRMHQRIVATARKVLEAGALELVTPIFEETQVFEK----------------------GVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYEHGMKVWPQPVRLWMAGPMFRAERPQK--RYRQFHQVNYEALGSENPILDA--EAVVLLYECLKELGLPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYE-DYYVRTFEVHHEEGPRVPGVGFAFGVERVALAL................................... 318
70 -9.4905xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  144.................................VDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFD---RGYYEVTPPTLVQTQVEGGATLFK----------------------------------DYFGEEAFLTQSSQLYLETCLPA---------DVFCIAQSYRAEQSRTRRHLAEYTHVEACPFLTFDDLLNRLEDLVCDVVD-FKRMNYSDAIVWLKESFYMQRCPEDSRL----TESVDVLMPNVGEGGSMRIFDSEEILAGYKRE--TDQRKYGTCPHGGYGLGLERFLTWILNRYH-DVCLYPRFVQR.................. 463
71 -9.4403i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  224.................................QDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTS---QKFVEIHTPKLIGCSSEGGSNIFE----------------------------------KYFDRKAYLAQSP-----QLYKQMAIMGDFRKVFE-VGPVFRAENSNTRRHLTEFEGLDMEIVENYHECIDVMEKLFTFIFD-FLRLTYKEAIEMLRAPFYTMPDIDDPNY----SNSYDVFV----RGQEITSGAQRIHDEFLMKRCIEKGVDPATLKHAGCGIGLERITMLYLGIPN-KVTLFPRDPIR.................. 545
72 -9.4203pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  10  38LTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAEETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEI----------------------------EDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRND--DQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEE-DLQIRFRPSYFPF--------------TEPSAEVDVMGKNGK-WLEVLGCGMVHPNVLRNVGI---DPEVYSGFAFGMGMERLT---MLRYGVT------DLRSFFEND............. 319
73 -9.3005c53_B mol:protein length:903 Pol gamma B  ali model follow..  373LLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLE---NGLIHLRSHISKLKDFLIKYISNVMRSRVAVRACHKVCRCLLSGFGGRVDAGQPELVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIE-GDHELLHMYPGNVSKLHGRDGRKNVVPCVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAP........ 798
74 -9.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  10  114.................................VDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYN---AGYVEVAPPTLVQTQVEGGSTLFN----------------------------------DYFGEQSFLTQSSQLYLETCIPT---------DVFCIAQSYRAEKSRTRRHLAEYAHVEACPFITLDDLMEKIEELVCDTVD-FLRMEYKDAIKWLQEAFYMQRDAKDNTL----TESVDLL--MPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYHGGYGLGLERFICWLTNTNH-DVCLYPRFVGR.................. 434
75 -9.1904j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  11  190.................................QDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLIN---KGFVEIQTPKIISAASEGGANVFT----------------------------------SYFKNNAYLAQSP-----QLYKQMCICADFEKVFS-IGPVFRAEDSNTHRHLTEFVGLDMAFNYHYHEVMEEIADTMCEALAMLREAGVEMKYPLAVRPFYTMPDPRNPKQ----SNSYDMFM----RGEEILSGAQRIHDQLLTERALHHGIDLEKIKHAGGGIGLERVTMLFLGLHN-QTSMFPRDPKR.................. 512

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.