current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst GPLGSDSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIPLast
1 -73.9003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model  100  1GPLGSDSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP 147
2 -69.4003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  97  1GSHMADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP 150
3 -44.9002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  16  18GGYTQSAPSQAEKKSRARAQHIVPCTISQLLSATLVDE--------VFRIGNVEISQVTIVGIIRHAEKAPYKIDDMTAAPMDVRQDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLED-MNEFTTHILEVINAHMVLS 170
4 -44.4004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  15  1.............GKKAGNNTLRPVTIRQILNAEQPHPDA------EFILDGAELGQLTFVAVVRNISRNAYSVEDGTGQIEVRQWSDDSSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVID-YNEVMFHRLEAVHAHLQVT 135
5 -40.3004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  6...................LAFAKLYIRDILDMKESRQV-----PGVFLYNGHPIKQVDVLGTVIGVRERDYGVDDSTGVINCICWKKLNTESTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDVWNIQIARMLELPTIYRKV. 159
6 -39.0003kf6_A mol:protein length:159 Protein stn1  ali model follow..  17  16...................SRWNPMFISDVHKISFHPH----LQRYIGFWMGFPIRWIQIVGYIAAIDIYELTVDDCSGMVLRVVFFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRD-PNDEWKAWQKRMRYKKNL. 146
7 -33.0003kf8_A mol:protein length:220 Protein stn1  ali model follow..  12  48....................KTIPLFISDINNSPNLYGYIADHLRHVVLVNNYPVNQINIFGKIVYEQYKELVISDFIGIDSKIRVKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELKDGLHFEFEQWKKRMEFRKNN. 206
8 -22.6001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  15  3GGFSGPSATQSQAGGFQGPNGSV-TTVESAKSLRDD-------------------TWVTLRGNIVEISDDLYVFKDASGTINVDI-DHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVN..................... 108
9 -14.5002k5v_A mol:protein length:104 Replication protein A  ali model follow..  13  12.......................................................LSGTINAEVVAAYPKSLFLKDDTGSIRGTLWNELADFE--VKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLE................. 98
10 -14.5002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  11  17.......................................................AETPVTGRVMKISSANVIIADDTGELRAVFWTENIKLLKKFREGDVIRIKDV-GGFGGRKEAHLMPRSTVEVLDPLE............... 109
11 -14.4003e0e_A mol:protein length:97 Replication protein A  ali model follow..  13  12.......................................................LSGTINAEVVTAYPKSLFLKDDTGSIRGTLWNELADFE--VKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKS................... 96
12 -14.1003dm3_A mol:protein length:105 Replication factor A  ali model follow..  20  15.......................................................MTATFEGEVISALPKSFIVRDETGSIRVTLWDNLTD--IDVGRGDYVRVRGIREGYYGGLECTANYVEILKKGEKIES.............. 105
13 -13.3002kbn_A mol:protein length:109 Conserved protein  ali model follow..  13  16.......................................................QWANLKAKVIQLWENVGLLGDETGIIKFTIWKN--AELPLLEQGESYLLRSVVGEYNDRFQVQVNKNSSIEKLSEPIEV............. 100
14 -12.7002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  15  13.......................................................ESVNVTVRVLEASEAEAIVGDETGRVKLTLWGK---HAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQIPENTPTAR 115
15 -12.6001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  16  13.......................................................ESVNVTVRVLEASEAEAIVGDETGRVKLTLWGK---HAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQIPEN..... 110
16 -12.5005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  14  15.......................................................KNLNLIFIVLETGRVTCKVADKTGSINISVWDD---VGNLIQPGDIIRMTGYASVFKGCLTLYTGRGGDLQ..................... 93
17 -12.2003kf6_B mol:protein length:105 Protein ten1  ali model follow..  14  22.......................................................QKLRFLGCVQSYKNGILRLIDGSSSVTCDV--TVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD...... 105
18 -12.2001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  12  1........GSSGSSGSTVKRKPVFVKVEQLKPGT---------------------TGHTLTVKVIEANIVECLIGDETGCILFTARND---QVDLMKPGATVILRSRIDMFKGTMRLGVDKWGRIE..................... 118
19 -12.0002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  14.......................................................PYVSVIGKITGIHKKQGYIEDDTARIRISSFGK------QLQDSDVVRIDARVAQFNGYLSLSVGDSSRIESVNVN................ 96
20 -11.9006d6v_F mol:protein length:121 Telomerase holoenzyme TEB heterotrimer Teb3 subunit  ali model follow..  14  24.......................................................KKVTVVGNVCNEDQNDSLVIFGPTGLNQHVVIDNYRRVDLNNTTKFVEIRGVV---LNQNIVSCEELTEFEQKDPFDFDTYSKLIHL..... 108
21 -11.9004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  11  5........................TFVKDIKPGL---------------------KNLNLIFIVLETGRVTCKVADKTGSINISVWDD---VGNLIQPGDIIRLTGYASVFKGCLTLYTGRGGDLQK.................... 94
22 -11.7002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  125.......................................................SGNIVYGVFMLHKKTVYEIQDDRGKMDVVGTGQCHN--IPCEEGDKLQLFCRLRKKNQMSKLISEMHSFIQ..................... 200
23 -11.6003f1z_A mol:protein length:133 putative nucleic acid-binding lipoprotein  ali model follow..  1GASKASAGDKLFQPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLG--------KWVKVRGVIVDIRRKSGIAGS-DKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK..................... 133
24 -11.4004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  124.......................................................TLIYGVFAVEKKKVNDFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK..................... 197
25 -11.3004gla_C mol:protein length:109 OBody NL8  ali model follow..  16  21.......................................................TEVVVAGWVASLGDYGVKVSDREGGAAVPVYLEAGKVFAELSREDVVVIKGIVEASKRGVEIFPSEIWILNKAKA................. 109
26 -11.2004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  12  110.......................................................TIVNGLFKVQKITEEKYGIHDKTGTMEVLVLGNPSK--TKCEEGDKIRLTFEVSKNGVKIQLKSGPCSFFK..................... 183
27 -11.2004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model follow..  19.......................................................QTVRIVGKVHKVTGNTLLMQTSDLNVEIAM-----TPDSDVSSSTFVEVTGKVSDAGSANQIREFTTVDCGHDVDLTLV-VVQISAAFPNL. 109
28 -11.1003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  13  137.................................................................KKKNILFDLSDNTGKMEVLGVRNEDTM--KCKEGDKVRLTFTLSKNGEKLQLTSGVHSTIK..................... 196
29 -11.1004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  14  124.......................................................RLVDGEFKVYRKSSGNYGIWDDTGAMKVVVSGQLTSV--NCEIGNTIRLVCELTSNADEWFLRATRYSYME..................... 197
30 -11.1004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  14  4...................KPGTYYLPWEVSAGQVPDG-----------------STLRTFGRLCLYDQSRVTLMAQHGSDQHQVLVCTKLVEPHAQVGSLYIVLGELQHQQDRGVVKARVLTCVEGMNLPLLEQAIREQRLYKQ.. 116
31 -10.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  16  19.......................................................SEVVVAGWVAHLGDYGVKVSDREGGAAVPVYLERGKVFAELSREDVVVIKGIVEATTVTREIFPSEIWILNKA................... 107
32 -10.4004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  16  19.......................................................SEVVVAGWVAHLGDYGVKVSDREGGAAVPVYLERGKVFAELSREDVVVIKGIVEALDTGVEIFPSEIWILNKA................... 107
33 -10.4004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  16  20.......................................................SEVVVAGWVAHLGDYGVKVSDREGGAAVPVYLERGKVFAELSREDVVVIKGIVEASEQYGEIFPSEIWILNKA................... 108
34 -10.2004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  120.......................................................TLIYGVFAVEKKKVNDFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK..................... 193
35 -10.2004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  124.......................................................TLIYGVFAVEKKKVNDFKIKDNEDNIKVVWDKEQHNI--NYEKGDKLQLFSHLRKGNGKPILHSGNHSFIK..................... 197
36 -10.0005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12  21.......................................................KIVKVAGWCNTYRDHGIDLRDKSGLVQLVCDPSSKEKALEVRSEFVLVAKGKVRL-TGKIEIVLEELIIENKS................... 109
37 -9.9603fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  13  1......................................................MNTLELSARVLECGAMRHT-RRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARVKVKLHLQQARRIAGSMGRDPLVGLE......... 109
38 -9.8704gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  16  23.......................................................TEVVVAGWVASLGDYGVKVSDREGGAAVSVYLEYGKTPDELSREDVVVIKGIVEASKAAAEIFPSEIWILNK.................... 111
39 -9.7905vbn_A mol:protein length:527 DNA polymerase epsilon subunit 2  ali model follow..  14  179.......................................................GDAIVLGMITQLKEGKFFLEDPTGTVQLDL-SKAQFHSGLYTEACFVLAEGWFED..................................... 232
40 -9.6402pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  12  34.......................................................KPVCFVGRLEKIHPTGKMFGEG-KNGTIEL-----MEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLY-AVKIIHDFPQF. 123
41 -9.3603en2_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  2......................................................INRLQLVATLVEREVMRYT-RQVEFSIEALGAGKMASVLDRIAPGTVLECVGFLARKHRSSKALVFHISGLE..................... 95
42 -9.3404fdb_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  2......................................................INRLQLVATLVEREVMRYT-RQVEFSIEALGAGKMASVLDRIAPGTVLDCVGFLARKHRSSKALVFHISGLE..................... 95

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.