current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3net_A mol:protein length:465 Histidyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLTLast
1 -131.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model  100  1SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT 465
2 -109.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  31  60....ESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS---------------KLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFD-PMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPK--LSQNKQALEGLGDLKLLFEYLTLFGIDD-KISFDLSLARGLDYYTGVIYEAVLLQTPAVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 514
3 -108.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  22  12GPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGE--------------EITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVK--SVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKT-----------IDEIAQRIGEEHEAVRELRDFITQIEAYGFGD-WVIFDASVVRGLAYYTGIVFEGFDRD-GNFRALCGGGRYDNLLTTYGSPTVPCVGFGFGDCVIVELLNEKKLLPEL-HHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV... 446
4 -107.0004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  31  3GSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS---------------KLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFD-PMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPK--LSQNKQALEGLGDLKLLFEYLTLFGIDD-KISFDLSLARGLDYYTGVIYEAVLLQTPAVGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 461
5 -107.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  22  12GPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGE--------------EITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVK--SVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKS-----------IDEIAQRVGEEHEAVKELRQFFEQVEAYGYGD-WVLFDASVVRGLAYYTGIVFEGFDRE-GKFRALCGGGRYDNLLTTYGSPPIPCAGFGFGDCVIVELLQEKRLLPDI-PHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL... 446
6 -104.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  24  1......MYRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGE--------------ELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRK-DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSD--SPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIG--GMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMI----------ADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKN--VRYDFSIVRGLSYYTGIVFEAYDRS-GQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIP--REKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQAT 426
7 -102.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  23  1GPGYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVV-----------EKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQ--GPDIDAELIMLTARWWRALGIEHVTLELNS----------IGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLD-----SKNPEVQALLNDAPALGDYLDE-----ESREHFAGLCKLLESAGIA---YTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFK-ADPVVDIYLVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG 431
8 -101.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  22  1.......GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIV-----------RKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSE--NPILDAEAVVLLYECLKELGLRRLKVKLSS----------VGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILD-----SKSERDQALLKGVRPMLDFLGE-----EARAHLKEVERHLERLSVP---YELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLP-EEKGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG 423
9 -101.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  22  2...........IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVV-----------QKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAE--NPSVDAEVLAMVMHIYQSFGLKHLKLVINS----------VGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDC-----KVDRDKEAIKTAPRITDFLNE-----ESKAYYEQVKAYLDDLGIP---YTEDPNLVRGLDYYTHTAFELMMDNPNAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELD-IEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK... 420
10 -99.5005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  22  1......MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIV-----------EKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVA--TPDIDAELIMLTARLWKRMGVDHVQLELNT----------LGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILD-----SKIESTQKILENAPKLHDFLKE-----DSLSHFQQLQDYLTAAGIK---FVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKSVPAVGFAMGMERLLLLLEQVEQAEI---VRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFT 431
11 -98.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  22  17..TEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIV-----------EKEMYSFVDANGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFA--GPDADAEIVMMCQRLWEDLGLTGIKLEINS----------LGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDT-----KNPALQEIVRNAPKLIDFLGD-----VSRAHFEGLQRLLKANNVP---FTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE--QEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMV 453
12 -89.3003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  18  1SNAMSK--PFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAI---------------LDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDG--TASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVG---YREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQT-----EKGKTALAEMTKLYEVLESYGASE-YVKFDLTLVLHMSYYTGVVFEGYGNRLG--VPLCSGGRYDELLSKF-HRPAQATGFGVRIDLLVEALNGEII-----SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA............................. 400
13 -82.8003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  17  12GARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS--------------RDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEA-SVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLA-AERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDVVTFDLALHRELDYYTGLVFEMFAPGVG--APIAQGGRYDELLAQF-GAGAPAVGFAFEVERVMAVLEAQEEGEGE.................................................................................................. 372
14 -77.1006FTT Entity 1(prereleased)  ali follow..  14  3.............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED--------------LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGD--GIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCE--SIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGS-------DFYTLARFGHDIANLLGRLSEN---AQQDTKIVTAIDELQRLKAHLQVQW--QCAVSIDVTELSGYHYHTGIVFNGYINSET--QPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI---VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLSLADNQWRLHAV....................................... 388
15 -77.1005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  3.............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED--------------LKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGD--GIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCE--SIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGS-------DFYTLARFGHDIANLLGRLSEN---AQQDTKIVTAIDELQRLKAHLQVQW--QCAVSIDVTELSGYHYHTGIVFNGYINSET--QPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI---VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLSLADNQWRLHAV....................................... 388
16 -71.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  16  5GSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFN-----------QEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDST--SARYSYFGKIFRKEKRHKGRSTENYQIGIELFGES--ADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTEL------LTELLLKKDLSGLNAFIEKNNFSK----ELRGLLKEIFITNELSRLENLVTNTKDD-----VLISSFDQLKEFSEKLSM-IKPIIIDLGMVPKMDYYTDLMFKAYSSAANQ--PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQELEEDND................................................................................................. 338
17 -61.5001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  19  2...................DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP------------------------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPD--SQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRN--SLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKEIPKDLHE-----KVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRS-----------PEHLKTMDLPLSVREDLLSASSFLQEKF-PTVSVEIDLTLARTIEEYCGLIFTIYDTSSS--RLVAAGGEYTVNGE-------KGVGGSIFLEGK............................................................................................................... 273
18 -49.5002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  26  3...........................................................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIELGPDESKQKFVLKTPKALE-EKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 164
19 -45.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  28KPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTEL---------------SKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTR----ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWG---IDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL.......................................................................................................................................................................................................... 268
20 -41.8003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  46....ELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTEL---------------SKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTR----ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPLDREWG-----IDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIS............................................................................................................................................................................................................. 279
21 -41.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  45KPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTEL---------------SKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTR----ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLESAVVGPRPLDREWGIDKPWIGAGF............................................................................................................................................................................................................................................... 253
22 -37.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  11  28KPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTEL---------------SKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTR----ENLESIITDFLNHLGIDFKIVGLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL.......................................................................................................................................................................................................................................... 268
23 -35.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  27KPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------------ELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSG----CTRENLESIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL................................................................................................................................................................................................................. 267
24 -35.3002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  12  51......ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------------ELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTR----ENLESIITDFLNHLGIDFKIVPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL.......................................................................................................................................................................................................................................... 285
25 -31.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  12  51......ESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------------ELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSG----CTRENLESIITDFLNHLGIDFKILELSSAVVGPIPLDGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL.......................................................................................................................................................................................................................................... 285
26 -29.1002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  10  47.EMGFSDALSRDRAFQGIEHRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDH---------------PLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEE--RHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMK........................................................................................................................................................................................................................................................................... 239
27 -29.0002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  15  36SHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESG---------------DAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARKSYNMFVAYLRTFARMGLKAIPMRAETGPI-----GGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIE--------------------------------VGQIFYF-------------GTKYSDSMKA-DGTDAPIH-YGVGVSRLLGAIDDNGIIWPEAVAPFRVTILNLKAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.... 452
28 -28.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  16  22SHQILLRAGYIRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESG---------------ETYGPNLYRLKDRNDRDYILGPETFTELIRDEINSYKRL--PLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQSYRYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYVLAFTKGIE--IGHIFKL-------------GTRYSDVLDENGREKSVIMGYGIGVSRLLSAIDERGINWPTGIAPFDLHVVQMNEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMN 566
29 -26.3005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  17  24SHQLLLRAGMIRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESG---------------EQYGPELLRLKDRHEREFCVGPEVITDLARNELNSYKQL--PINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRDHELNEIKAA-TLVIKRGIE--VGHIFQL-------------GTKYSEVLSEQGKPVNLIMGYGIGVSRVVAAADERGILWPSALAPFQIALVPLTESVKQATDKLYAELTAAGFEVLLD-KKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLS 572
30 -23.5004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  22...............PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG---------------DNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRP------KRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRL-----------------ASYVGEDNERKVPVMIHRAILGSMERFIGILTEEF------------AGFFPTWL-----------------------------------APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 394
31 -22.3005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  12  17TQAIVRSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGF------------SPEVAWVTHYGDSPIAIRPTSETIMYPAYAKWIRSHRLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELVLILELYRRWYEECLAVPVIKGEKS-------------------------------------------------------------------------------EGEKFAGGKKTTTVEAFIP-----ENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSW-----------------GCTTRSLGVMIMDKGLVIPPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRID-SNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELME 388
32 -22.2001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  12  29...............QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLSGHEATFADPMVDNAKARYWTPPRYFNMMRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQP-----------PESSAHYAKATVDILYRFPHGSLELE----GIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGK------------------------------WFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI------------------LVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 441
33 -22.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  12  19LEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGF------------SPELAVVTHAGEEPLAVRPTSETVIGYMWSKWIRSWRLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEVRMLSIYARLAREYAAIPVIEGLKTE-------------------------------------------------------------------------------------KEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGA--------------IMTHGDDRGLVLPPRLAPIQVVIVPIRERVLEAAQGLRQALLAQGLRVHLD-DQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLD 386
34 -22.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  30SQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAD--------FAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEVQILDLYAQVYEELLAIPVVKGRKT-------------------------------------------------------------------------------EKEKFAGGDYTTTI-----EAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQN-------------SWGLT---TRTIGVMDNMGLVLPPRVACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 407
35 -22.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  12  21TQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGF------------SPEVAWVTKYGDSEIAIRPTSETIMYSVFPKWIRSYRLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRW----------------------------------------------------------YEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHY-------------------------LGTNFAKMFKIEFEDENEVKQYVHQTSW---------------GCT---TRSIGIMDDKGLVLPPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYD-ASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLV 392
36 -21.9005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  25SQVIVKSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGF------------SPEVAWVTKSGKSDIAIRPTSETIMYPYFAKWIRSHRLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEALEMVDIILNEYASI----------------------------------------------------------YEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHL-------------------------LGQNFSKMFGVEFEDEKGNKEYAHQTSW---------------GLT---TRAIGVMDNKGLVLPPKVAPVQVIIIPIIEEQKKICNEVECILKKAGVRVKID-SNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLE 396
37 -21.9004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  13  46SQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEK---------------VADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWVQSHRLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEVLILDLYAQVYEELLAIPVVKGRKT-----------------------------------------------------------EKEKFAGGDYTTTIEAFISASGRAIQGGTSHH-------------------------LGQNFSKMFEIVFEDPKIPGEKQFAYQN-------------SWGLT---TRTIGVMDNMGLVLPPRVACVQVVIIPCGEALIAKCNDYRRRLLSVNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 423
38 -21.9001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  13  261...............AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSG---------------DHYQEDMFPMQLDETESMVLRPMNCPHHMMIYANKPHSYELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDK--KYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPERF-----------------LTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEET------------KGAFPTWL-----------------------------------APKQVQIIPVNVDLYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIR 640
39 -21.8004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  26...............PGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--------------GHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPE------KFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI---------------QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY------------GGKWPFWL-----------------------------------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 399
40 -21.7005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  13  18TQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGF------------KPEVAWVTHYGDSELAIRPTSETIMYPAYAKWIRSHRLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLVLILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQ-----------------------------------------------------------------------------------------ATSHLLGQNFSRM---------------FSIEFEDEKGAKQLVHQTSWGCTRSLGVMDDKGLVLPPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVD-TNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLE 389
41 -21.4005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  18IDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGF------------APEVAWVTRAGDTEVAVRPTSETVMYPYYAKWIRSHRLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEVEILECYASVYEQLLAVPVVRGRKTEK-----------------------------------------------------------EKFAGGDYTTTVETFIEAVGRGCQGATSHN-------------------------LGQNFGKMFDIRFQDPENNEQTLIPWQN-------------SWGLS---TRVIGVMDNRGMVMPPRVASTQVIIIPVGQELLASCWRLESELCEGGVRARCD-DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAAL. 394
42 -21.4004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  22...............PGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--------------GHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGF-SFKLNLSTRP------KFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATI---------------QLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY------------GGKWPFWL-----------------------------------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 395
43 -21.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  13  39HNILEEAEIIDQRYPKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGF--------EDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQVRAVEIYKEFFNSLGIPYLITRRPPW--------------------------------------------------------------------------------------DKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEQTCYGLSDRVIASV----------------IAIHGDESGLCLPPDVAAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMK 407
44 -20.6001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  13  25............YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKG--------FEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTLPIKIYQIVNTFRYEKHTRPLIRLMTFKEAHTAHSTKEEAENQVEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYT--------------------------------------------------------------------------------------MAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIAS--------------IAIHGDEKGLILPPIVAPIQVVIVPLKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLN 380
45 -20.5001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  13  258............EEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--------------GHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRP------KRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRL-----------------ASYVGEDNERKVPVMIHRAILGSMERFIGILTEEF------------AGFFPTWL-----------------------------------APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 633
46 -20.1003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  25.RVPVFNREFATFTGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSG---------------EFYRNNMYLFDIE-GHEFAVKPMNCPYHILLFLNEVAKHPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLFK-TFKVRLSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTI--------QFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHR------------RGRMPFTL-----------------------------------APIQFAVIAVKTGGEDLASSIAKGLLDKGFRVAVKGSSKTLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVE 440
47 -19.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  11  36............YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGF------------EAECFWVEQPLEERLALRPTSETAIYSMFSKWVRSYKLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQLDYWKVIDTIFSDELCFKGQKLRRVCW-------------------------------------------------------------------------------------DRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCA---------------GISTRVLACALSIDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESADTLKSKLGLRVSID-FSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVRDVGKDQKRVIPITEVMKVSSHTTE 401
48 -18.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  45............PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS-GHWENYADDMFKVETTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNEL---------PLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINF-HFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERF-----------------LKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSN------------EGRWPFWLNPYQAVIIPVNTKNVQQLDMCTALQKK-------------------RNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEK 451
49 -18.0002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  14  90..............VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSGSEMESVLAQLDNYGQQELADLFTFIGPGGNMPGYLRPETALNFKRLLEFNQGKL--PFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFQNVAMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESK----TSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEG-LTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLAN 657
50 -17.7001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  14  2............................................................................................................................................................................................................................................................................................................................................................................SSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYE 106
51 -17.6001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  12  123......................ENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPR----NMMF-----------QDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQP-----------PESSAHYAKATVD----ILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKW------------------------------FVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVI------------------LVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 504
52 -14.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  15  15.........................IDIQTKILDYMTKFFTDRGFKWLLPIMLPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE----------------------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK--------DVMRLIEELI--------------YGLFRKAEEWTG-REFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIAR-------------------------------------GKLKPSAGAGIGVERLVRFIVGAKHIAEV.................................................................................................. 281
53 -13.5001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  15  15.........................LDIQTKILEYMTDFFVKEGFKWLLPVIISPTDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK----------------------KIFVLSPNIRLESRQKDDGREFTQLDFEV------ERAKMEDIMRLIERLV--------------YGLFRKAEEWTG-REFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAK-------------------------------------GKLKPSAGAGIGVERLVRFIVGAKHIAEV.................................................................................................. 281
54 -13.1005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  94...............GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDSAFRAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD---------------------------CQDEEGRKGNKLYYNFPWGKELIETL-----WNLGDHELLHMYPGNVSKLHGRDGRKNVVPCV----------------LSVNGDLDRGMLAYLYDSFQLTENSFTRKK---------------------------NLHRKVLKLHPC--------APIKVALDVGTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 480
55 -13.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  13  119EKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPF--------------------LTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLD------RYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVEAMERYGSDKPDLRFGSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKRETSPHPEDLPLLEKDPGRVRALAYDL-VLNGVEVGGGSIFRLLGIGEEEQRE-----KFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIR-------EVIAFPKNKEGKDPLTGAPSPVPEEQLR................................................................. 571
56 -12.9003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  15.......................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHL---------------FPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPV------FQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVD--DLLQQVLDCQPAESLSYQ-------QAFQRHLEIDPLSAD-KTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEV-------------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLP-QNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADV.................................................................................................. 318
57 -12.9002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  10  77...............GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDSAFRAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD---------------------------CQDEEGRKGNKLYYNFPWGKELIETL-----WNLGDHELLHMYPGNVSKLHGRDGRKNVVPCV----------------LSVNGDLDRGMLAYLYDSFQLTENSFTRKK---------------------------NLHRKVLKLHPC--------APIKVALDVGTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 463
58 -12.6003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  11  28.......................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHL---------------VPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPV------FQLCRSFRNEEMGRYHNPEFTMLEWYRPHYD-------YRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEI----DPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEV-------------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLP-QNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEV.................................................................................................. 331
59 -12.5004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  71................CHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDSAFRAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD---------------------------CQDEEGRKGNKLYYNFPWGKELIETL-----WNLGDHELLHMYPGNVSKLHGRDGRKNVVPCV----------------LSVNGDLDRGMLAYLYDSFQLTENSFTRKK---------------------------NLHRKVLKLHPC--------APIKVALDVGTLELRQVCQGLFNELLENGISVYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 456
60 -12.1003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  13  222...VSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS------SEGGSNIFEV----------------KYFDRKAYLAQSPQLYKQMAIMGDFR------KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVENYH-----ECIDVMEKLFTFI-----------DEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATL----------KDYIESF------------------RFG---------SWPHAGCGIGLERITMLYLGIPNIRKV.................................................................................................. 536
61 -11.8004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  112DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPT--------------------LTRSTPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEM------SFVEADDVIAISEQVLKAVTIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPTAPKPDSVDTFDSDPGNALSDAYDI-VCNGNEIGGGSVFAMMGIDHDEAQE-----KFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIR-------EVIAFPKSGGGVDPLTDAPQQRKESGIDAKPREDKPKEDAKSKAAAA.............................................. 601
62 -11.8003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  11  131NKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPP------TIVKTQCEGGSTLFKLQYFNEPA---------------LTQSSQLYLESVIASLG---------KSFCMLSSYRAEQSRTVRHAEYLHLEAELISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAF--YMSKVPGHPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPY----------YWYTQQR------------------KYG---------SCPHGGYGLGVERLVMWLLGEDHIRKV.................................................................................................. 444
63 -11.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  48...............DGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASD....................................................................................................................................................................................................................................................................................... 229
64 -11.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  156LPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTP------KLLGAPSEGGSSVFEVTYF----------------KGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTD-----LDKFPLEIRPFYTMPDPANPKYSNSYDF-------------------FMRGEEILSGAQHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRA.................................................................................................. 478
65 -11.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  13  128DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPT--------------------LTRSTPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEM------SFVEADDVIAISEQVLKAVTIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFDTFDSDPGNALSDAYDI-VCNGNEIGGGSVFAMMGIDHDEAQE-----KFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIR-------EVIAFPKSGGGVDPLTDAPQQRKESGIDAKPREDKPKEDAK.................................................... 611
66 -11.7005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12  131DEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPT--------------------ITRSTPEGARDFLVPARLHPGSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEM------SFVDAEDIIAISEEVLTELLIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVESQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERIFFSAGPVKSSRALLGAARVLFEPADEATAAGEVAVGSGAWTAVHHAFTADAYDIVCNGHE----IGGGSKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIR-------EVIAFPKTGGGVDPLTDAPAPITAQQRK................................................................. 596
67 -11.5004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  12  118YSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPI--------------------LGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFD------RYYQIAKCFRDEDLRADRQPEFTQIDIET------SFLDESDIIGITEKMVRQLEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPNPGAALSRAYDM---VLNGTELGGGSIFRVLGIDEAEQEE-----KFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIR-------EVIAFPKTQSAGDVMTQAPGSVDGKALR................................................................. 580
68 -11.5004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  11  185RATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTP------KIISAASEGGANVFTV----------------SYFKNNAYLAQSPQLYKQMCICADFE------KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYHYH-----EVMEEIADTMVQI-QERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK-------------------------------------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQT.................................................................................................. 503
69 -11.4003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  48...............DGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASD------------------------------------------------------PFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFG------TWGIQDANGEPAHTGCV-------------------------------------AFGMDRLAVAMFHT........................................................................................................ 308
70 -11.4001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  10  56...................RFGPLGVELRKNLASQWWSSMQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGALEHYCLDLVNRKLPFGLAQIGVCFHPVSNSNQRVGEKTEASLVWFTPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQ--------------------------------------------DELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNV-----------STIQGRDGRKNVVPCVLSDVDLGTLAYLYDSFQLAENSFARKKSLQRKVL--KLHPCLAP---IKVAL----------------------DVGKGPTVELRQVCQGLLNELLENGISVWPGYVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLA 438
71 -11.3005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  11  146.VLLSPCYHMLPTAISGLKD-SRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIY--------------------GGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLD------KVYEIGKNFRNEGIDLTHNPEFTAMEF-YADYYDLMDLTEELISGLVLEIHGSLKIPDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFEL-------------FVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVE-ETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEV.................................................................................................. 507
72 -11.3001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  13  113NHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPM--------------------LTKATPEGARDYLVPSRVHKGKFYAL-PQSPQLFKQLLMMSGFD-----RYYQIVKCFRDEDLRADRQPEFTQIDVETYGSDKPDLRNPMELTDV-ADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKW--PMFEDDGEGGLTAMHHPFTS-VINGYEVGGGSVFGILGINEEEQRE-----KFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIR-------DVIAFPKTTAAACLMTEAPSFANPTALA................................................................. 577
73 -11.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  10  139NEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPP------TLVQTQVEGGATLFKLDYFGEEA---------------LTQSSQLYLETCLPALG---------DVFCIAQSYRAEQSRTRRHAEYTHVEAEC------PFLTFDDLLNRLEDLVCDV-----RILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPEYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPY----------YWYTDQR------------------KYG---------TCPHGGYGLGLERFLTWILNRYHIRDV.................................................................................................. 454
74 -11.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  13  179.......................KVARQRIAVMRAIRSALERRGFLEVETPMLQTLA--------------------GGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFE------RVFELNRVFRNEGADSTHSPEFVMLET-YGTYDDSAVVTRELIQEVADEAIGTRQVPDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWE--HTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDL-------------YVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDE-EDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSI...................................................................................................... 490
75 -10.9005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  12  157EESRVRQRYVDLIVRPQAREVA----RQRIAVIRAVRNALERRGFLEVETPMLQTLA--------------------GGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFD------RVFELNRVFRNEGSDSTHSPEFSMLET-YGTYDDSALITRELIQEVADEAIGTRQLSDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFA-DDEAMQLDEDFLTALEY-------------------------------------PCTGTGMGIDRLLMCLTGLSI...................................................................................................... 486

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.