current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3nip_A mol:protein length:326 3-guanidinopropionase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAARSALELast
1 -106.0003nip_A mol:protein length:326 3-guanidinopropionase  ali model  100  1MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAARSALE 320
2 -100.0003nio_A mol:protein length:319 Guanidinobutyrase  ali model follow..  47  1MDKNLHQPLGGNEMPRFGGIATMMRLPHVAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKHGKVGLVHVDAHADVNDHM-FGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR.... 319
3 -100.0001gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE  ali model follow..  43  2......ERIDSHVSPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEHGPLAVVHLDAHSDTNPAFY-GGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHRTQ... 312
4 -94.9004dz4_A mol:protein length:324 Agmatinase  ali model follow..  37  14.AIRRPSVYGSSIENTYAGVLSFMRRNYTRDLDGVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPYPWFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKKPLSLIHFDAHCDTWADD-APDSLNHGTMFYKAVKDGLIDPKASVQVGIRTWN--------DDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRKAGAR.. 324
5 -92.0001wog_A mol:protein length:305 agmatinase  ali model follow..  30  1........MSGPAHLPYGGIPTFARAPLVQPDGQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTR-NDTKWSNSSPFRRACEA-LPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADL----AGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHV...... 304
6 -86.6003lhl_A mol:protein length:287 Putative agmatinase  ali model follow..  26  3.............................LNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLED-YNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEYNDIYVIHFDAHTDLREEY-NNSKNSHATVIKRIWD--IVGDNKIFQFGIRSG--TKEEFKFATEEKHTYMEIGGI------DTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIISNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKE.... 280
7 -86.0003pzl_A mol:protein length:313 Agmatine ureohydrolase  ali model follow..  26  6.........NGREKDHASELRSIFSLKKINGYEEAKYVVFGIPFDNTSSYRRGSKYAPDSIRGAYVNLESYEYSYGIDLLA-SGMADLGDMEE-SEDVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRALPK--DVDLVIVDAHSDFRSSY-MGNKYNHACVTRRALD--LLGEGRITSIGIRSV--SREEFEDPDFRKVSFISSFDVKKNGIDKYIEEVDR--KSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERL-SYKAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYYKEHI.. 305
8 -85.5003m1r_A mol:protein length:322 Formimidoylglutamase  ali model follow..  24  4.MDKYPFLREAGSSFKDRDVTKMSDLIATDGQDIKGPALIGVPLSKSSISHSGASFAPGTIRQALKHSSAYSAELGEHVVS-ELLYDLGDIDIHVTDIVKSHHHIFQTMHALLSDHPVPLILGGDNSISYSTIKAIAQKGTTAVIQFDAHHDVRNTEDG--GPTNGTPFRRLLDEEIIEGQHLIQLGIREFSNSQAYEAYAKKHNVNIHTMDMIREKGLIPTIKEILPVVQDDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELLEAVKYIQQPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSPFK.... 322
9 -82.0002a0m_A mol:protein length:316 ARGINASE SUPERFAMILY PROTEIN  ali model follow..  23  4..............AARTDDPRLLSLFSAQREEDADIVIIGFPYDEGCGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDITAS--TLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAGDVGVINVDSHLDVRPPL-QDGRVHSGTPFRQLLEESSFSGKRFVEFACQGSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTG-KNTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAKTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATRPKPKAEN 310
10 -80.0004rhm_A mol:protein length:351 Arginase  ali model follow..  23  3..............SSSSGLVPRGSHMF-------SKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLDDIVIVHFDAHPDVSD---------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHTEEE 323
11 -77.1004rhi_A mol:protein length:351 Arginase  ali model follow..  22  3..............SSSSGLVPRGSHMFS---KFLMNVKGVTPRG----SDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLDDIVIVHFSARPSVSD---------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTHTEEE 323
12 -73.4002eiv_A mol:protein length:291 Arginase  ali model follow..  30  3...................................RVAVVGVPMDLGAN-RRGVDMGPSALRYARLLEQLEDLG--------YTVEDLGDVPVSLARASRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGRRVGVVWVDAHADFNTPETSPSGNVHGMPLAVLSGLGAVDPKDVVLVGVRSL--DPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI......... 290
13 -72.6001pq3_A mol:protein length:306 Arginase II, mitochondrial precursor  ali model follow..  23  2...................................SVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELCISSASIVYIGLRDV--DPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTRE.... 305
14 -72.1001d3v_A mol:protein length:323 PROTEIN (ARGINASE)  ali model follow..  22  2..............................SSKPKPIEIIGAPFSKG-QPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELCISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHK 313
15 -71.8001wva_A mol:protein length:322 Arginase 1  ali model follow..  25  2..............................SAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELCISAKDIVYIGLRDV--DPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGN.. 311
16 -70.5001t5f_A mol:protein length:314 Arginase 1  ali model follow..  22  2...................................PIEIIGAPFSKGCP-RGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARHPDLAVIWVDAHTDINTPLTTSSGNLAGQPVAFLLKELAISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTKREGNHK 308
17 -70.4005ynl_A mol:protein length:362 Arginase  ali model follow..  21  14.ETAAAKFERQHMDSPDLGTDDDDKMSPATLATPRTAGIVGCPFSGG-QPKAGVHSGPLQLIESGLLNDIENLGWTVDALAVSIVSDTPDPDIGRLKVSRVTKDVADRVYAHASKGQLTVTLGGDHSLAMGTVSGTFKYPEACLIWVDAHADINTPHTTESGRLHGCPVSFLLGLDCLKPERIVYIGLRDI--DAGERKILKDNNIKCFSMFHVDKYGIGKVVEMALDHVRTRPIHLSFDVDALDPSVAPSTGTAVRGGLTFREGHYICEAIETNLLVSLDIMEINPSLGALAQTVDVGRSLVRCALG............ 352
18 -69.0001xfk_A mol:protein length:336 Formimidoylglutamase  ali model follow..  20  16......DPEDGQAGRRVHHIACPIQVGELAN-QEPGVALIGFECDAGVKGRTGAKHAPSLIKQALANLAWHH---------PIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHPRIGIINFDAHFDLRESELAPVRPSSGTPFNQIHHFCQQQDFHYACLGVSRASNTPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQSIRH. 335
19 -66.8006dkt_A mol:protein length:296 Arginase  ali model follow..  24  2.................................DKTISVIGMPMDLGQA-RRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPIIKNDEELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKYDNLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGIGKIKPENVVIIGARSL--DEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYLACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKL......... 295
20 -66.5001cev_A mol:protein length:299 PROTEIN (ARGINASE)  ali model follow..  28  3...................................PISIIGVPMDLGQT-RRGVDMGPSAMRYAGVIERLERLHYDIPIGKAERLHEQGDSRLRNLKVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGKIKPEHVVLIGVRSL--DEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKEDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKL......... 298
21 -65.5004q3p_A mol:protein length:385 Arginase  ali model follow..  19  4.SSSGLVPRGSHMMLKSVATPYYPIQDEKPKLLYTSANFLGIPTNRG-QPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCGDIIPVELNEAEDPQRRVEELMKQSNKHTVELSGSKSTPVIVGGDHSMATGTILGHAEKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFLVKELCLNASNIAYIGLRDL--DAHETHDIRKHGIAYFTMLDVDRMGIEAVIKEALLAVLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATKLSVVELAELNPLLGSQEKTQSSAVHILRACLGHCRSGHLPFKVR 361
22 -65.0004ity_A mol:protein length:330 Arginase  ali model follow..  22  3.............................GSGMAKKMSIVLAPFSGGQP-HSGVELGPDYLLKQGLQQDMEKLGWDTKVVEARKASDNGDRIGRVKRTAECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSHPDAGVIWVDAHADINTMSGTVSGNLHGCPLSILLGLDVLKPNKIAYIGLRAV--DDEEKKILHDLNIAAFSMHHVDRYGIDKVVSMAIEAVGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIECGRLVALDVVECNPLLAATESHVNDTISVGCAIARCMMGETLLYTPH 319
23 -64.4004g3h_A mol:protein length:330 Arginase (RocF)  ali model follow..  19  1....................................MILVGLEAELGAS-KRGTDKGVRRLREALSATHGDVIKQTITQERCVLYKEFRYAKNFEDYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVKKIGILYLDAHADIHTAYDSDSKHIHGMPLGMVLNRVEIDPKCLVYFGVRS--TEQSERDVIRELQIPLFSVDAIRE-NMQEVVQKTKESLAVDIIYLSLDLDIMDGKLFTSTGVRENNGLSFDELKQLLGLLLESRLKAVEVTEYNPTVSIKHNNEKQVLEILDLIINSCKIKDKKHS.. 317
24 -59.5003mmr_A mol:protein length:413 Arginase  ali model follow..  19  82................................INNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNNFYGNYEENNVISTNDKYKNNCEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQYQNLRVIWIDAHGDINIPETSPSGNYHGMTLAHTLNLTYLKPENTAIIGIRDI--DAYEKIILKKCNINYYTIFDIEKNGIYNTICTALEKISNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLE.... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.