current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLCSGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDALast
1 -114.0003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model  100  1SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLCSGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA 400
2 -95.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  21  14GSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEE---HEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRDGNRALCGGGRYDNLLTTYGSPVPCVGFGFGDCVIVELLNEKKLHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARG 420
3 -94.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  21  14GSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGE------EHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDREGKRALCGGGRYDNLLTTYGSPIPCAGFGFGDCVIVELLQEKRLPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERG 420
4 -91.5001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  25  2.....YRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIG--GMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARI--TGKSSEEIARMAAVEDLLASYGVKN-VRYDFSIVRGLSYYTGIVFEAYDRSGQRAILGGGRYDNLASLMSGSVPAVGFGMGDAVISLLLKRENVREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERG 397
5 -91.2003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  27  14RAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEAVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDLLANLLTWSPAERDAEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLADVVTFDLALHRELDYYTGLVFEMFAPGVGAPIAQGGRYDELLAQFGAGAPAVGFAFEVERVMAVLEAQEEGEGE................................................................ 372
6 -89.6004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  19  58PDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN---KLTNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMGLAPEVADRIGDYVQQHGGVSQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGMFDPKVPCVGLSIGVERIFSIVEQRLETTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKPKLLNQLQYCEEAGIPLVAIIGEQELKDG 485
7 -89.2003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  18  1SNAMAKKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQEQFNLGVSELETVITGVRNLGVPDRFCIDLAIARGLNYYTGTVYETTLIGHEGSICSGGRYEELVGTFGEKMPGVGISIGLTRLISRLLKAGIPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQ 436
8 -88.8004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  19  5EFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN---KLTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMGLAPEVADRIGDYVQQHGGVSQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGMFDPKVPCVGLSIGVERIFSIVEQRLETTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDG 432
9 -88.7001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  21  1........MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLH------------TDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIP--YTEDPNLVRGLDYYTHTAFELMMDNPNTTLCGGGRYNGLLELLDGSETGIGFALSIERLLLALEEEGIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENN 394
10 -88.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  22  7IEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYSNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQI--KDSTSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQ---LADGSTELLTELLLKKDLSGLNAFIEKNNFS----KELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQELEEDND............................................................... 338
11 -86.6004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  20  1.....GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLE------------LNPMRILDSKSERDQALLKEVRPMLDFLGEEARAHLKEVERHLERLSVP--YELEPALVRGLDYYVRTAFEVHHEEIGAALGGGGRYDGLSELLGGPVPGVGFAFGVERVALALEAEGFEKGPDLYLIPLTEEAVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAG 394
12 -86.6005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  20  2.....AMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFGDATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLT------------TNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIK--FVINQKLVRGLDYYNKTVFEWTTTALGSTVCAGGRYDGLVGQLKGKVPAVGFAMGMERLLLLLEQVEQIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRQGSMKSQMKKADQAGAVYAIILGEREWEAQ 402
13 -86.5006FTT Entity 1(prereleased)  ali follow..  24  3...........LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGD--GIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMG----SDFYTLARFGHDIANLLGRLSAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQNQPRQATGFSMDVSRLLAHTQLDAPFIVDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV.......... 388
14 -86.5005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  24  3...........LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGD--GIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMG----SDFYTLARFGHDIANLLGRLSAQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQNQPRQATGFSMDVSRLLAHTQLDAPFIVDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHADNQWRLHAV.......... 388
15 -86.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  20  3GYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMY------------TNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIA--YTVNQRLVRGLDYYNRTVFEWVTNSLGSTVCAGGRYDGLVEQLGGATPAVGFAMGLERLVLLVQAVNPDPVVDIYLVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANG 402
16 -82.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  20  17TEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFGEVTDIVEKEMYSFVDANGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDD------------DAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVP--FTINPRLVRGLDYYNLTVFEWVTDKLGATVAAGGRYDPLIEQLGGKTAACGWAMGIERILELLKEEHLQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILDGAGASFKSQMKRADASGAAFAVIFGEDEVTNG 417
17 -76.6001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  17  2.................DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP---------AGNFFLDRKGNLFSIREDFTKTVLNHRKRY--SPDSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLKE--IPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPL------SVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVAAGGEYTVNGE------KGVGGSIFLEGK............................................................................. 273
18 -46.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  31.RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKH..................................................................................................................................................................................... 246
19 -42.9003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  14  45.RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSA---LVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNG................................................................................................................................................................. 277
20 -42.7004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  48.RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAGPRPLDREWGIDKPWIGAGFGLERL............................................................................................................................................................................................ 258
21 -40.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  14  31.RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDK-LERLLKVKHDFKNIKRA.................................................................................................................................................................................... 254
22 -38.3002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  48.RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSCMVYGDTL.................................................................................................................................................................................................................................. 219
23 -38.3004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  30.RELESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFG------LERLLKVKHDFKNIKR........................................................................................................................................................................ 252
24 -34.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  48.RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVG............................................................................................................................................................................................................................................ 209
25 -31.9002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  61.QGIEHQLMSQGKRHLEQLRVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLE......................................................................................................................................................................................................................... 243
26 -29.2002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  9...................................................................................................................................................................................................................................................................................................LVKLQGERVRGLKQQKASAKAQLGPDESKQKFVLKTPKALETTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDG 135
27 -23.1002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  48..........QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGAR-KMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIE----------------------------VGQIFYF-----------GTKYSNVTGPDGTDAPIH-YGVGVSRLLGAIIEACHDAPFRVTILNLDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEG 427
28 -20.8002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  27...LRAGYIRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVGAGFGSIGPVNVSEDVKIDLAVQDLANAIVGALAFTKGIEIGHIFKLGTRYSDVLDENGREKSVMGYGIGVSRLLSAIVEQNADER-DLHVVQMDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADLIGCPIRITVGKKAVDG. 537
29 -18.7005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  14  29...LRAGMIRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLGAGPGSLGPVNLPIACIVDRSVALMSDFAAGTLVIKRGIEVGHIFQLGTKYSEVLSEQGKPVNLMGYGIGVSRVVAAAIEQNHDER-QIALVPLTESVKQATDKLYAELTAAGFEVLLDDRDKKTSVKFADMELIGIPHRIVISDRGLSEG 543
30 -18.4004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  14  9GKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGDNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRP-------------------------------EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIE-------TLYDCLDRAWQCGTVQLDFSLPSRLSAYVGEDNERKVPVMIHRAILGSRF--LTEEFAGFFPT-------------------LAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESG 365
31 -17.5001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  12  261.............AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGDHYQEDMFPPMLDETESMVLRPMNCPHHMMIYANKPHSRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYSFRLS----------------------------RDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVA-------LTEETKGAFPT------------------LAPKQVQIIPVNVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENN 611
32 -17.4004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  11  13GRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTR----EKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIK---------DAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY----------GGKWPFWLS-----------------------------PRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISG 370
33 -17.1004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  11  9GRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIED-EIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIK---------DAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY----------GGKWPFWLS-----------------------------PRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISG 366
34 -16.9001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  12  25....AELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEPELAVVTHAGGEPLAVRPTSETVIGYMWSKWIRSRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEVRRML-----------------------------------------------------------------SIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIFQD---------------DLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVGLRQALLAQGLRVHLD-DQHTPGYKFHEWELKGVPFRVELGPKDLEGG 358
35 -16.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  35SQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKSGENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKKDRSNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVKGGSGAESN----------------------YFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLD-------MVTDHLRKTHQVATIQLDFQLPERFDLFKDMIHRATFGSIERFMA-------LIDSNEGRWP-FWLNPYQAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQ 421
36 -16.1004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  10  55.......IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKM---------------------------------------------IVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDN------MGLVLPPRVACV-------------QVVIIPCGITNALSEED------KEALIAKCNDYRRRLLSVNIRVRADLRDNSPGWKFNHWELKGVPIRLEVGPRDMKSC 394
37 -16.0001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  13  248GKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGDNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRP-------------------------------EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIE-------TLYDCLDRAWQCGTVQLDFSLPSRLSAYVGMIHRAILGSMERFIG-------LTEEFAGFFPT-------------------LAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESG 604
38 -16.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  10  39.......IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVAAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKM---------------------------------------------IVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDN------MGLVLPPRVACV-------------QVVIIPCGITNALSEED------KEALIAKCNDYRRRLLSVNIRVRADLRDNSPGWKFNHWELKGVPIRLEVGPRDMKSC 378
39 -15.9003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  10  36..........YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKAECFWVEQPLEERLALRPTSETAIYSMFSKWVRSKDLPLKIHQTCTIFRHETKNT-RVREIHWNEAHCCHATAEDAVSQLSDYW-----------------------------------------------------------------KVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFD----ILYA-----------ANESVHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESADTLKSKLGLRVSIDDDFSSMGDKLYYYELKGVPLRIEVGQRDLANG 370
40 -15.8001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  12  52..........YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKDEVYWVTSKLQRKLALRPTSETVMYPMFALWVRSTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIP---------------------------------------------------------------------YLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFE----IKFE-----------EGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKG 378
41 -15.7003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  12  40..............GVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGEFYRNNMYLF-DIEGHEFAVKPMNCPYHILLFLNEVAKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDFEEMKLVLERLFKLGVSSETFKVRLSM--KEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKL---FIMMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHR----------RGRMPFTLA-----------------------------PIQFAVIAVKTGGEVDASSIAKGLLDKGFRVAVKGSSKTLSSDVRHIESTAKPAVVFIGAKEVREK 411
42 -15.4005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  23...KAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEPEVAWVTRAGDTEVAVRPTSETVMYPYYAKWIRSRDLPVRLNMWNNVIRWEFSHP-RTREFLWQEGHCAWAKAEECAKEVLEIL---------------------------------ECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETF--IEAVGRGCQGATSHNLGQNFGKMFD-----IRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVM-----------------PPRVASTQVIIIPVGITKDTTEEARQELL--------ASCWRLESELCEGGVRARCDLRDNSPGWRFNHWEVKGVPLRVELGPRELAER 366
43 -15.3001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  10  25..........YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEADEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVTDLPIKIYQIVNTFRYETKHT-LREIMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTM---------------------------------------------------------------------AFDTIFPDGRTMQIATVHNLGQNFSKTFE----IIFE-----------TGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENK 351
44 -15.2005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  10  32.............SGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEPEVAWVTHYGDSPIAIRPTSETIMYPAYAKWIRSRDLPLKLNQWCSVVRWEFKQP-RTREFLWQEGHTAHATEEEAW-ELVLDILELYRRW----------------------------------------------------------EECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIE-----FED---------------EGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPITGEILGKCRELKTMLEKADIRVRIDDRSNTPGWKYNHWEVKGVPLRLELGPKDLAKG 359
45 -15.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  10  40.............SGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEPEVAWVTKSGKEPIAIRPTSETIMYPYFAKWIRSRDLPLKINQWTSIVRWEFKHP-RTREFLWQEGHTAHSTRKEAL-EMVDIILNEYASI---------------------------------------------------------YEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVE-----FED---------------KGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVITCNEVECILKKAGVRVKIDDRSNTPGWKYNHWEVKGVCLRFEVGPRDIEKR 367
46 -14.8004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  36.............SGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEPEVAWVTKYGDSNIAIRPTSETIMYSVFPKWIRSRDLPLKLNQWNTVVRWEFKQP-RTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRW----------------------------------------------------------EEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIE-----FED---------------NEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTTDECKDIEKILKNAQINCVYDDRASSPGYKFNHWELRGIPIRIEVGPKDLQNN 363
47 -14.4005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  33.............SGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEPEVAWVTHYGDSELAIRPTSETIMYPAYAKWIRSRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQ--------------------------------------------------------------------------------ATSHLLGQNFS--MFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGGCRELERLLNAAGVRVKVDDRTNTPGWKFNDWELKGVPLRLEIGPRDVESC 360
48 -14.1001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  11  29.............QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYSGNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGE-------------------------------ERIVLKLKPQLAPIKVAV-------------------IPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQS 403
49 -13.5001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  15  15.......................LDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKDDGREFTQLDFEV-----ERAKMEDIMRLIE-----------------RLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLGGEREWEYEKIVAKIRKAGLNE---------DSFRPYLE-----------------------IAKAGKLKPSAGAGIGVERLVRFI......................................................................... 272
50 -13.5003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  14  8................SRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGL------------------FRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLGGEREWEYEKIVAKIRAAGLKE---------DSFRPYLEIA-----------------------RAGKLKPSAGAGIGVERLVRFI......................................................................... 272
51 -13.3003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  2...MSETATWQPSASIPNL-----LKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLE-DLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDPQQPIDQNLLDALAA------------------------------GLP-DCSGVALGVDRLVMLALGAESLADVIAF............................................................. 321
52 -12.7003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  12  28.....................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLE-DLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLRAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDPQHPIDQNLIEALKV-------------------------------GMPDCSGVALGVDRLVMLALGAETLAEVIAF............................................................. 334
53 -12.1003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  15  1.....................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPSADLNCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKAPYSEDYHLGLWVTGKMVSNS-YELKAYVENIFKRLGLDLHSLVVGN......................................................................................................................................................................................................................................... 162
54 -12.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  14  1.....................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRAAYAEDDRLGIWICGQRVHNS-FELKAVVEQVLCRVGIETGAYTLKT......................................................................................................................................................................................................................................... 162
55 -12.0001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  10  104.KEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPRNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPYQQ------------PPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG------------------------KWFVPYVIE-----------SAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVILVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQS 466
56 -10.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  14  244.......................FRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGS------NIFEV-KYFDRKAYLAQSPQLYKQMAIMGDFR------KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVENYH---ECIDVMEKLFTFI-----------PKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDF--------TTPQEVKLGELIKAKYNTDFYAAIRPFYTMPDIDDPNYSNSYDV-FVRGQEITSGAQRIHDPEFLMKRCIEKG-YIESFR-FGSW-PHAGCGIGLERITMLY......................................................................... 527
57 -10.7004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  210.......................FRLQSGICHLFRETLINKGFVEIQTPKII------SAASEGGANVFTV-SYFKNNAYLAQSPQLYKQMCICADFE------KVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPL-----------AVRPFYTMPDPRNPKQSNSYDM-FMRGEEILSGAQRIHDPQLLTERALHHGKIKAYIDRFGAP-PHAGGGIGLERVTMLF......................................................................... 494
58 -10.5001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  181.......................FRIQAGVCELFREYLATKKFTEVHTPKLL------GAPSEGGSSVFEV-TYFKGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYH---EVLDTLSELFVFI----------------------ELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYNPKYSNSYDFFMR----------GEEILSGAQHALLQERM-GCPPHAGGGIGLERVVMFY......................................................................... 469
59 -10.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  12  175...............ANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELEVLGTTKVTYGEHVFDFMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFIGGREIGNGFSELNDAEDQAERFGDDEAMFYDEDYVTALEY-------------------------------GLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK...................................................... 504
60 -10.4003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  16  180..................LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTASQFDEELYKVIDGEDEKYLI-ATSEQPISAYHAGEWFESPLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLE........................................................................................................................................................................................................................... 355
61 -10.4005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  11  170...............VRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFD------RVFELNRVFRNEGSDSTHSPEFSM--LETYQTYGTYDD--SALITRELIQEVADEDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVG-RSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFGDDEAMQLDEDFLTALEY-------------------------------GMPPCTGTGMGIDRLLMCLTGLSIRE.................................................................. 488
62 -10.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  13  137.......................FKIRSSVFKAVRDFFHENGFIEIHTPKII------ATATEGGTELFPM-KYFEEDAFLAESPQLYKEIMMASGLD------RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIEDEE---EVMSFLERLVAHA-----------NYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDI--------DTEGERLLGKYMMENENAPLYSEAKPFYIMKYDNKPEICRAFDL-EYRGVEISSGGQREHRHDILVEQIKEKGSFEFYLKRYGMP-PHGGFGLGAERLIKQM......................................................................... 417
63 -10.2001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  17  104...........................TLMERELVEIFRALGYQAVEGPEVENFDALNIPEHHPARDMGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQ--LEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRF........................................................................................................................................................................................................................................... 253
64 -10.1005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  11  133...........................GIDIDEEKKERLREVLHLYKKGAIDIAKALNVSNEMGLKVLFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQRDRSHLMSYHSASCVVVGEDVSVDD--GKVVAEGLLAQFGFTKFKIEVATFGVYSPIA-NLGLGVERLAMIIYGYEDVRAMVYPQFYRLSDRDIAGMIRVDKVPILDEFYNFANELIDICIANKDKESPCSVEVKREFNFNG--PNKKLLGPSVLNEVYVYDGNIYGIPPTF-----GVKEQYIPILKKAKEE----GVSTNIRYIDGIIYKLVAKIEE---ALVSNVDEFKFRVPIVRSLSDINLKID-ELALKQIMGENKVIDVRGPVFLNAKVEIK.... 553
65 -10.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  12  137................RRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLD------RYFQIARCFRDEDLRADRQPDFTQLDLEM----SFVEVEDVLELNERLMAHV---RFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPLGAVRLRAADLLGLKREGFRFLWVVDFPLLEALAYDLVLN--GVEVGGGSKFGFFLEEYGAP-PHGGIAWGLDRLLALMTGSPSIRE----VIAFPKNKEGKDPLTEEQLRELGLMVV.................................. 578
66 -10.1001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  11  175...............SNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELDILGKTEVTYGDVTLDFMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFIGGREIGNGFSELNDAEDQAQRFGDDEAMFYDEDYVTALEH-------------------------------GLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK...................................................... 504
67 -9.9301n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14  125.......................LKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGDYFEKRAY---------LAQSPQLYKQIMVGVFE---------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIADEE---DLMRLEEALLAEM-----------EEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPV-------------GQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRSFDLLFR----------GLEITSGGRYEELLESL-GMPPHGGFAIGAERLTQKL......................................................................... 401
68 -9.8703m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  11  156.......................LQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGS------TLFKLQYFNEPALTQSSQLYLESVIASLG---------KSFCMLSSYRAEQSRTVRHAEYLHLEAEL----PFISFEDLLNHLEDLVCTV-----------DNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYG---------------------------EDISEKPERQMTDEIGCPIFMIHFPSKMKAFYM---VDLLMPGVGEIVGGSMRIWNYQRKYGSC-PHGGYGLGVERLVMWL......................................................................... 435
69 -9.8706aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  12  173...............VRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFE------RVFELNRVFRNEGADSTHSPEFVM--LETYQAYGTYDD--SAVVTRELIQEVADEDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWE--SHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFGDDEAMALDEDFLAALEY-------------------------------GMPPSTGTGMGIDRLMMTLTGLSIRE.................................................................. 492
70 -9.8101x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  12  135.......................MKVKETLIMAAREWLLKDGWHEVFPPILV------TGAVEGGATLFKL-KYFDKYAYLSQSAQLYLEAAIFG---------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYM-----------QRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYG------KHIKAFYMKEDPNDPRKVLASDMLAPEGYGEIIG--YDKLLNRILEEGMDPKDYEWYLDRYGSV-PHSGFGLGVERLVAWV......................................................................... 413
71 -9.8105w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  149................RDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYAL-PQSPQLFKQLLMVAGME-----RYYQIARCYRDEDFRADRQPEFTQLDMEMFGTDKP--DLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSG-GHEIGGGSKFGFLLEAFMFGAPP-GIAFGWDRTTALLAGMDSIRE----VIAFPKTGGGVDPLTAQQRKESGIDAQPKRVQQA........................... 610
72 -9.8104rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  13  130................REGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPPQLFKQLLMVAGME--------RYYQIARCYRDEDFRADRQPEFTQLDMEMVEADDVIAISEQVLKAVEAMRRFGSDKPDLRFGIE---RTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPFDSDPGNALSDAYDIVCN--GNEIGGGSKFGFLLDAFSYGAPP-GIAFGWDRITALLAGVDSIRE----VIAFPKSGGGVDPLTPQQRKESGIDAKPREDKPKEDAKSKAAAALE............... 603
73 -9.7502xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  12  134.......................LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGS------TLFNL-DYFGEQSFLTQSSQLYLETCIPT---------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFIT------DLMEKIEELVCDT--------------VDRLLADEEAKKL--------------------LEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYM---VDLLMPGVGEIVGGSMRIWKFQRLYGTC-PHGGYGLGLERFICWL......................................................................... 416
74 -9.7205eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  178...............LNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLD------KVYEIGKNFRNEGIDLTHNPEFTA--MEFYMAYADYYDMDLTEELISGLVLEIHGSLKIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHQTMSPLAKWHREKPEMTERFEFVLGKELCNAYTELNEPLQQRKFFEQQADEHGLP-PTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQH................................................. 522
75 -9.7004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  35DHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGKSFPNLLGCVCGLHGTELVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLT................................................................................................................................................................................................................................................. 221

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.