current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVILast
1 -126.0003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model  100  1MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI 294
2 -124.0001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  83  1MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI 294
3 -90.3003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  22  143.RHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT-------QCEGGSTLFKLQYFNEPAYLTQSSQLYLESVI-ASLGKSFCMLSSYRAE--QSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPFKRMTYADAIKYCNDERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYG-SCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP. 456
4 -89.8005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  20  151.RHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQT-------QVEGGATLFKLDYFGEEAFLTQSSQLYLETCL-PALGDVFCIAQSYRAE--QSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHERPFKRMNYSDAIVWLKEERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYG-TCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP. 466
5 -89.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  197.RVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISA-------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAED--SNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVEPTLRLEYCEALAMLREHLVKEKYDTDFYILDKYPLAVRPFYTRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFG-APPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP. 515
6 -88.5002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  20  121.RHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQT-------QVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIP-TLGDVFCIAQSYRAE--KSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLPERPFLRMEYKDAIKWLQEERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYG-TCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP. 437
7 -88.5001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  23  122.RHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAE--KSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIETEPPFPRISYDEAIDILQSERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDSDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYG-SVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP. 434
8 -87.8001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  23  124.RFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIAT-------ATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEE--HNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELDILNPFPRVSYDKALEILGDKYMMENENAPLYFLYQYPSEAKPFYINKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYG-MPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP. 438
9 -87.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  168.RVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGA-------PSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAEN--SNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKMVRLTYKEGIEMLRAKLVRDKYDTDFYILDKFPLEIRPFYTANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYG-CPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP. 490
10 -87.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  23  121.RVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIAS-------ATEGGAQLFPVIYFGKEAFLAQSPQLYKEL-MAGVVERVFEVAPAWRAEE--SDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNPIKRLKYTEAIEILRSRILNEELKEDLYFIVDWPSDARPFYTENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYG-MPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP. 429
11 -87.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  21  231.RMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGC-------SSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAEN--SNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRPFLRLTYKEAIEMLRAELIKAKYNTDFYILDKFPAAIRPFYTDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFG-SWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP. 548
12 -85.7001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  20  112.RYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMV-GVFERVYEVAPVWRME--EHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGDIPRLTHAEAKRILKEEYAKERWGSDWLFVTRYPRSVRPFYTEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYG-MPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP. 422
13 -68.20011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  13  3...TAYI-AKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGDGTQDNGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQAGEGLYTHMKALRPDE-DRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSELPDQIHFVHSQELLSRYPGRERAIAKDLGAVFLVGIGGKLSDGHRHNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGE-MPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP. 327
14 -65.1004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  5.GYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRVD--DVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCHLLLAYPNLTAKEREREIAREYYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGE-FPQTVGGGIGQSRMVMFMLRKKHIGEVSVWPEEIRKKHNL 350
15 -64.9001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  23  131.RYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKST----PEGARDFLVPYRHE--GLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRAD---RQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGV-----ELPLPFPRLSYEEAMERYGSDKPDLRTYMHHPFTSPHPEDLPLLEKDGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYG-APPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPL 558
16 -62.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  124.RYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST----PEGARDFLVPARLQ--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY------DLPLPLPRISYEEAMRRFGSDKPDLRTAMHHAFTAPKPDSVDTFDSDPNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYG-APPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPL 564
17 -62.4005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  143.RYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRST----PEGARDFLVPARLH--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGY------RIPTPIPRIGYAEAMRRFGTDKPIDPDAWAFVWVVDPPLFEPAESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFG-APPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPL 583
18 -62.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  130.RFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPT----PEGARDYLVPSRTY--GHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRAD---RQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLD------VEFDEFPHMPFEEAMRRYGSDKPDLRI--APMWVVDFPTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYG-APPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVM 567
19 -61.6004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  19  140.RYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRST----PEGARDFLVPARLQ--GSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRAD---RQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY------DLPLPLPRISYEEAMRRFGSDKPDLRTAMHHAFTAPKPDSVDTFDSDPNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYG-APPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPL 580
20 -59.1004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  135.RYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRT----PGGAKEFLVPSREP--GKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPD---RQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKD------PVVVPFPTMTFAEVLATYGTDKPDTRF--SFLWVVDFPLFLPKEENPRKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYG-APPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLM 575
21 -58.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  125.RYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKAT----PEGARDYLVPSRVH--GKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRAD---RQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKG------VDLGDFPVMTFAEAERRYGSDKDGEGGLTAMHHPFTSPKDMTAKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYG-TPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLM 564
22 -49.9003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  9......QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEM---GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSA-LLFTMGVEPHIGKEKPTFIYHFPASQASLSTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLLDALAAG-LPDCSGVALGVDRLVMLALGAESLADVIAFT......... 322
23 -49.7003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  162.RYLDL-NDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGI---DLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHIPEGQAYDVDFTPPFRRINMVEELEKALGGEFLEVTCINPTFICDHPQIMSPWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYG-LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP......... 503
24 -49.2005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  16  164.RYLDL-NPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGI---DQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYVYEVDFTPPFRKVNIYDGLQEKLGGEFLEPTFISPTFLTGHPQIMSPWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQA-ENYCTALEYG-LPPTAGWGMGIDRLAMILTDSNNIKEVLFFP......... 506
25 -49.1003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  13.SHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEM---GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKLFTFGVEPNIGKEKPTFVYHFPASQASLSTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLIEALKVG-MPDCSGVALGVDRLVMLALGAETLAEVIAFS......... 335
26 -48.8005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  20  172.RYLDL-NEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGI---DLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHEGKCIEIDFTTPWKRFSFVEEIESGLGGHFVETKCTNPSFIIDHPQTMSPWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKAS-ETFCLALEHG-LPPTGGWGLGIDRLIMFLADKNNIKEVILFP......... 511
27 -48.6006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  17  167.RYVDL-RDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGA---DSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRGTVYDLDGEWESIQMYPSLSEALGEHTVGAKLWAPTFVKDFPVETTPSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAA-EDFLAALEYG-MPPSTGTGMGIDRLMMTLTG-LSIRETVLFP......... 497
28 -48.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  169.RYLDL-NDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGI---SVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVVTYGEHVFDFGKPFEKLTMREAIKKYRPDEVAEAHLIQPTFITEYPAEVSPRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAA-EDYVTALEYG-LPPTAGLGIGIDRMIMLFTNSHTIRDVILFP......... 498
29 -48.5004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  162.RYLDL-NESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGI---DNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFENQPIEIDFTPPYPKVSIVEEIEKLASHFIENKYNDKPFFIVEHPQIMSPYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREK-SAFCTSLEYG-LPPTGGLGLGIDRITMFLTNKNSIKDVILFP......... 502
30 -48.4004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  16  160.RYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPG-----GATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQT---HNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDILEIKDRLMDINNEEDIKMLEKFFKEPIPGEKIPRPLDGPEALTFLKKQLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHA-FPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELE 568
31 -48.3005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  16  164.RYVDL-RPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGS---DSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRGSVYDIDGEWATMEMYSSLSEALGEHAVGNKLTAPTFVKDFPVETTPQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAA-EDFLTALEYG-MPPCTGTGMGIDRLLMCLTG-LSIRETVLFP......... 493
32 -48.2003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  18  160.RYLDL-NPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGI---STRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVIQYGEHLVDLTPEWRRLHMVDAIKEYVGEQKVEDKLIQPTFIYGHPVEISPKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQ-EDFLEALEYG-MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFP......... 488
33 -48.2001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  169.RYLDL-NDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGI---SVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDIVTYGDVTLDFGKPFEKLTMREAIKKYRPEEVAEAHLIQPTFITEYPAEVSPRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDA-EDYVTALEHG-LPPTAGLGIGIDRMVMLFTNSHTIRDVILFP......... 498
34 -47.7004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  23  184.RYVDL-TPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGV---SPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDAIQYQGRELDLAQPFHRLTITQAIQKYAPEETAEAQLWEPTFIIDYPIEVSPESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDA-ADYIRALEYG-MPPTGGCGIGIDRLVMLLTDSPTIRDVLLFP......... 517
35 -46.6006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  230.RYLDL-NDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGI---DLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITEGQAYDVDFTPPFRRINMVEELEKALGGEFLEVTCINPTFICDHPQIMSPWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYG-LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP......... 571
36 -26.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  23  72...............NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK---EHLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 271
37 -26.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  18  73.RHLEQLRTV--KHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLMLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGA---QHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAA----------------------------------------------REFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDE----------------------KWEIFDPWVGLGFGLERLLMIREGTQHVQSMA............ 288
38 -26.5005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  23  51...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGK---EHLEEFTMLAFAQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 254
39 -25.4002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  22  68...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLNFCQMGSGRENLESIITDFLNHL---------------------------------------------------DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 271
40 -25.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  21  44.....LQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPAPNIFNYARKLDR--KIFEIGPCYRKESDGK---EHLEEFTMLNFFQMGSGRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMH-------------------------------------------------GDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 253
41 -21.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  21  68...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL-----------------------------------------------DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARS.......... 274
42 -21.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  21  59.....LQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLVFWQMGSGRENLESIITDFLNHL---------------------------------------------------DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 268
43 -20.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  22  51...........EERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGK---EHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL-----------------------------------------------DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDR----------------------EWGIDKPWIGAGFGLERLLKVKHDFKNIKRA............. 254
44 -16.5002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  50..................TRTVEEIEDLFLGLGYEIVDGYEVEQD-EALNLPKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRD---SDDATHSHQFTQIE---KNIKMSDLKGTLELVAKKLFGADREIRLR--PSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWI----------------------------EILGAGM---------NVLEMAGFDSNEYSGF-------------AFGMGPDRIAMLKYGIEDIRYF............. 269
45 -15.9003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  30.......QDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWKAAESTQVGIERIGEEASDVLRLLHEASAAAVPRLLDALGISLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDELDYYTGLVQFGAGAPAVGFAFEVERVMAVLEAQEEGEGEC............ 373
46 -15.5001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  15  104..................TLMERELVEIFRALGYQAVEGPEVESALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSRIVVPGRVFRFEQT---DATHEAVFHQLEGLVV-IAMAHLKGAIYELAQALFGPDSK----------------------------------------VRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGM--------PKVFQAVDAYRERLGLPPAYRGVTGF----AFGLGVERLAMLRYGIPDIRYF............. 335
47 -14.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  15  81..............MAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRGRY--EFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNALEGLGDLKLLFEYLTLFGIDDKGLDYYTGVIRYDGL-PCVGLSIGVERIFSIV...................... 404
48 -14.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  28..............MAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDNPAMTRGRY--EFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNALEGLGDLKLLFEYLTLFGIDDKGLDYYTGVIRYDGL-PCVGLSIGVERIFSIV...................... 351
49 -14.4003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  15  26..............KRLELYLLDTIRRVYESYGFTPIETPAV-ERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKARYQMDVVFRGERAKDGRFR---QFRQCDIDVVGRE--QMPAIITEIFRKVLTGFFQSLNSETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIAR-GEKMPGVGISIGLTRLISRLLKAGILNTL............. 367
50 -14.4004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  16  110..................TRTLERIEQCFSRIGYEVAEGPEVEDD-EALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPRIVCPGRVYRCDSDLT----HSPMFHQVEGLLV-VSFADLKGTIEEFLRAFFEKQLEVRFR--PSFFPFTEPSAEVDIQCVICSGNGCRVCKQTGWL----------------------------EVMGCGM---------NVLRMSNIDPEKFQGF-------------AFGMGAERLAMLRYGVNDLRLF............. 326
51 -14.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  5ARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAY-RLWMAGPMFRAERPQKGRYR---QFHQVNYEALGSE--EAVVLLYECLKEL--GLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAH-LKEVERHLERLSVPVRGLDYYVRTARYGPRVPGVGFAFGVERVALAL...................... 318
52 -13.8003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  110..................TRTIDRIESFFGELGFTVATGPEIEDD-DALNIPGHHPARADHDTFWFDTTRLLTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQ---THTPMFHQMEGLIV-ISFTNLKGTLHDFLRNFFEEDLQ----------------------------------------IRFRPSYFPFTEPSAEVDVMG----KWLEVLGCGM---------NVLRNVGIDPEVYSGF-------------AFGMGMERLTMLRYGVTDLRSF............. 315
53 -13.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  37..............MRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHR-VALRPEMTPSLARLLLGKKWYSIPQCWRYEAITRGRRR---EHYQWNMDIVGVK--ELVCAACWAMRSL-RKVLQTVVEQAGVTSDKPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQ--------RVGEEHEAVKELRQFFEQVEAYGYGDRGLAYYTGIVRYDNL-PCAGFGFGDCVIVELL...................... 343
54 -13.5003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  17.......RDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPA---EFEQLGVELIGDG--EVIALMIAALKRALMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEK-----------GKTALAEMTKLYEVLESYGASELHMSYYTGVVKFHRPAQATGFGVRIDLLVEAL...................... 327
55 -13.3001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  20..............MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGRE-VTLIPEATPSTVRMVTSRRWYSFPKVWRYEEPQAGRYR---EHYQFNADIFGSD--EVIALASSILDRL-RKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQ-------LRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKVRGLSYYTGIVRYGESVPAVGFGMGDAVISLLL...................... 321
56 -13.2005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  6IVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCV--RVWYMGPMFRYEKPQKGRYR---QFHQFGVETFGVA--ELIMLTARLWKRM--GVDHMVQLELNTLGETDRTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQK-----ILENAPKLHDKEDSLSHFQQLQDYLTAAGIKVRGLDYYNKTVRYDGL-PAVGFAMGMERLLLLL...................... 322
57 -13.2002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  12IQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAG-RLWYIGPMFRHERPQKGRYR---QFHQLGCEVFGLQ--ELIMLTARWWRAL--GISEHVTLELNSIGSLERANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQA-----LLNDAPALGDDEESREHFAGLCKLLESAGIAVRGLDYYNRTVRYGRATPAVGFAMGLERLVLLV...................... 323
58 -13.1006FTT Entity 1(prereleased)  ali follow..  10  8.......ADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSR---TPLQLGAEIFGCE--ELIDVLFSMINRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTFNGYINQLATNQPRQATGFSMDVSRLLAHT...................... 319
59 -13.1005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  8.......ADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHRYCYAGDVIHTLPSGLFGSR---TPLQLGAEIFGCE--ELIDVLFSMINRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTFNGYINQLATNQPRQATGFSMDVSRLLAHT...................... 319
60 -13.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  2IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSY-KLYYNGPMFRYERKQKGRYR---QFNQFGVEAIGAE--EVLAMVMHIYQSF--GLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKE-----AIKTAPRITDNEESKAYYEQVKAYLDDLGIPVRGLDYYTHTARYGPSETGIGFALSIERLLLAL...................... 317
61 -13.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37..............MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITKGGHR-VALRPEMTPSLARQLLAKKWYSIPQCWRYEAITRGRRR---EHYQWNMDIIGVK--ELVCAACTAMRKILQTVVEQAG--VSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQ--------RIGEEHEAVRELRDFITQIEAYGFGDWRYDNLLTTYGSPTAVPCVGFGFGDCVIVELL...................... 343
62 -12.9003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  228..................LKVRSQFRQIFLEMGFTEMPTDNFIESSDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQKYFSIDRVFRNE---TLDATHLAEFHQIEGVVA-LTLGHLMGVLREFFTKLGIT-------------------------------------------LRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGV---------EMLLPMGLPENVSVI--------------AWGLSLERPTMIKYGINNIREL............. 477
63 -12.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  26LTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDALNLTLRPENTAAVVRAAIEHRLWYIGPMFRHERPQRGRYR---QFHQVGVEALGFA--EIVMMCQRLWEDL--EINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFL----------GDVSRAHFEGLQRLLKANNVPVRGLDYYNLTVRYGKPTAACGWAMGIERILELL...................... 337
64 -12.3001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  30..............VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHESITLRYDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRST---ENYQIGIELFGES--EILSLALQVIEQLFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLI--------------SSFDQLKEFSEKLSMIKPKMDYYTDLMNFQEEAFAIGFCCHMDTILKAL...................... 328
65 -12.0002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  13  118..............ITKREVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEFKELKPISSTLTLRSHMTTG--KLFSIDRCFRREQGEDAT--RLYTYFSASCVLV-LSVDDGKAVAEALLRQFGFENFR----------------------------------------FRKDEKRSKYYIPDT-----------------------QTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTANLGLGVERLAMILYGYDDVRKMV............ 347
66 -11.2004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  56............LYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAPIAASRGPLPKGGLRFDVAADCFRREPSKH---DRLQSFRMREY-VCIGTPDDVSDFRERWMVRA-----------------------QAIARDLGLTFRVDY-ASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHR-EHFGTTWGIQDANGEPAH-------------TGCVAFGMDRLAVAMFHTHGT-DLSAWPA........ 318
67 -11.0005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  12  133..................GIDIDEEKKERLREVLHLYKKGAIDGDIAKALNVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSG--KLFSIDRCFRREQREDRS--HLMSYHSASCVVV-VSVDDGKVVAEGLLAQFGFTKFK----------------------------------------FKPDEKKSKYYTPETQTEVYAYHPKLGEEVATFGV---------IALAKYNIDVPVM----------------NLGLGVERLAMIIYGYEDVRAM............. 354
68 -10.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  10  56............LYESIVERLAALITS-HREAGTEALRFPPVMSRVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAAAADCFRREPSKH---DRLQSFRMREY-VCIGTPDDVSDFRERWMVRA-----------------------QAIARDLGLTFRVDY-ASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHR-EHFGTTWGIQ-------------DANGEPAHTGCVAFGMDRLAVAMFHTHG--DLSAWPA........ 318
69 -10.5001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  11  4................LDFEKVFSFYSKATKKGFSPFFVPALEKAEEPAGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPDSQI-----KVWYADFVYRYSGSDLV------AEYQLGLEKSLDDSLEVLEIIVEVYEDLLKEIPKDLHEKVNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYRLVAAGGEYTVNEKGVGGSIFLEGKT......................... 274
70 -10.2002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  11  225..............ARIFRTFEKIVLEELLEPGYREMIFPKLVTWEADYYKVTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGET-KVFDRGTSHRYESGGIHGIERVDEFHRIEI-VWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKAR------------------------VTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPD----------------EFQNVSINGDKYPKGFNVKLQSGDELWSGSGVGLERWAAVFLAQKG--DPANWPE........ 500
71 -10.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  10  185..............VFLNQALINYGLSFLSSKGYVPLQAPMMNKEVMAKTAQLSQFDEELYKVIDGEDEKYLIATSEYHAGEWFESPAERYAGYSSCFRREAGSHGKDAWVHAFEKIEQEKSWEEFDRMIGCSEEFYQSL--RVVGIVSGELAAAKKYDLEAWFPFQQEYK-------------------------------------------ELVSSNCTDYQSRNLEIRCGIKQQNQQEKKY---------VHCLNSTLSATERTICCILENYQKEDGLVIPE........ 429
72 -9.7902i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  61..............HRVLKKIEQIVREEQNRAGAIELLMPTLQLAD--RIADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPL-----NLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGGTKYSDSMKANPDGTDAP-GSYGVGVSRLLGAIIEACHDDNGIIWP......... 354
73 -9.5003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  12  206............GLVQLQVALVSYSLDFLVKRGYTPFYPPFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEYHRGRWFTEL--KYAGMSTCFRKEAGAHGRDTRVHQFDKIEQEESWRHLEDMITTSEEFNKSL--RVVNICSGALAAAKKYDLEAWFPASGAFR-------------------------------------------ELVSCSSQSVNCRYGPNLRGTAAQNVKEYCHMLN-----------GTLCAITRTMCCICENYQTEEGVVIPD........ 455
74 -9.3503w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  15  220............PMAALFEVLRDFLLERVTRKGFEPALFPKLIPLETYVWGELNERTLGSLKEKLRDPGYVLAPAQCEPFYELLRDEV-KLYDCGWTYRWEGGAAKGLERVNEFQRIEH-VWIAEPEEAYRIRRELLEAT-----------------------KRVAEELELEWKVVV-SDDPFYLEGRLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWI--------SVGSFNVHGEHFVDGFNVKEKSGRTLFTGAGLGVTRWVVGLLGLPEVPKTLTWPE........ 527
75 -9.2501wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  13  211............AGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCPNAKPSQIYNIDPSRFEDLNLAGTAEYFMDHSVAFR--RMVCSSTCYRAETDTGKEPWRVHHFTKVEMEQSSELLEEFLSLQMEILTEL--RVLDMPTQELPAYRKFDIEAWMPGRGRFG-------------------------------------------EVTSASN----TDFQSRRLHIMFQTEAGELQFAHTVN--------ATGCAVPRLLIALLESYQQKDSVLVPP........ 456

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.