current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .
# Score Template Links and tools%idFirst MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDALELast
1 -152.0003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model  100  1MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDALE 516
2 -127.0006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  50  3.MLDINLFREYKGGNPEIIRESQRRRFADVTLVDKVIELDEVWRATIGKLNHIKSFTGIISKEVGNRMKNKVPLGDDLELPKEFTKEALEQGSLAKLNTNQLKKLSTYITEVHIKNSEEEVKQKEKERDDVLLQIGNIVHETVVVSDNEDNNGIVRMKVDPETGYKCLKHIDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVTG---------EGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVGAHGKDTLGIFRVHQFEKIEQFVVTSPKDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAWFPGGNEYRELVSCSNCTDYQTRRLEVKYGKSKKQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPYMGGTKFI.................................................. 475
3 -125.0003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  48  6MVLDIQLFRDET--GANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEADGDTSEIPPQVKEAYELKGEQVEQLCVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQV---------SGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIE--MIRFENNAQAEGTTPDKGE............................... 484
4 -121.0002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  38  1.MLDIKLIRE----NPELVKNDLIKRGEKVKWVDEILKLDTEWRTKLKEINRLRHERNKIAVEIGKRRKKGE--------------------------PVDELLAKSREIVKRIGELENEVEELKKKIDYYLWRLPNITHPSVPVGKDENDNVPIRFMEYEILEWKPKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV-----------EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKDTKGIFRVHQFHKVEQFVYSRP--EESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTD--EKPRYVHTLNSTAIATSRAIVAILENHQEEDGVRIPKVLWKYTGFKE--IVPVEKKERCCAT..................................... 455
5 -119.0001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  23  34.LLDMESLCA----YPEDAARALDLRKGELRSLPGIISTWQELRQLREQIRSLEEEKEAVTEAVRALVVNQDNSQVQ------------------QDPQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHPDVPVGDESQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNI-------DPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETD-TGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAG---ELQFAHTVNATGCAVPRLLIALLESYQQKDGVLVPPALQPYLGTDRIT---TPTHVPLQYIGPNQPQKPRLPGQPASS.................... 495
6 -119.0001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  27  1.MVDLKRLRQ----EPEVFHRAIREKGVALD-LEALLALDREVQELKKRLQEVQTERNQVAKRVPKAPPE----------------------------EKEALIARGKALGEEAKRLEEALREKEARLEALLLQVPLPPWPGAPVGGEEANREIKRVGGPP-EFSFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI-----------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEG---RVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPYMGKEVLE.................................................. 418
7 -119.0002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  35  1.MIDINLIRE----KPDYVKERLATRDKELVLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGK--------------------------DTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC-----------ERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHP--DTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKT--GKNRFVHTLNGSGLAVGRTLAAILENYQQEDGVVVPEVLRDYVGTDVIR.................................................. 423
8 -118.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  45  1.MLDINAFLVEKGGDPEIIKASQKKRGDSVELVDEIIAEYKEWVKLRFDLDEHNKKLNSVQKEIGKRFKAKE--------------------------DAKDLIAEKEKLSNEKKEIIEKEAEADKNLRSKINQVGNIVHESVVDSQDEENNELVRTWTPETGAPAKLSHHEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVID---------GEDEKYLIATSEQPISAYHAGEWFESEQLPVRYAGYSSCFRREAGSHGKDAWGIFRVHAFEKIEQFVLTEP--EKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQEKKYVHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKYIPGEPE-FIPYIKELPKNTTSVKKAKGKNPKNTTSVKKAKGKNGSR........... 479
9 -115.0003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  25  110...QIRSIIM----RENFIPTIVNFSAEEIS-DAIREKMKKNYMSNPSYNYEIVNRASLAAGPMVKWAIAQL--------------------------NYADMLKRVEPLRNELQKLEDDAKDNQQKLEALLLQVPLPPWPGAPVGGEEANREIKRVGGPPEFSFPPLDHVALMEKNGWWE-PRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI-----------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEG---RVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPYMGKEVLE.................................................. 527
10 -60.1003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  13  22IEPTVEEFVKE--ANEDLLQRGVPTGKEGAKILYDTIYMEITGTRYLRPHEAAMRVRKRLAERLGRKHRVGVRDLKIPRYEVVLRFDREVT------YDYVGYVPVADDVVVEDGTVRLTFQDVDEERRHVIDRVIRLVAWAVEERSELVERVKVEPGTVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVTRKGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVCPPKRDPEEKLRDPGYVLAPAQCEPFYELLRDEVVDPERLPIKYDCSGWTYRWEGGA----AKGLERVNEFQRIEHVWIAEP--EEAYRIRRELLEATKRVAEELELEWKVVLLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEH--FVDGFNVKEKSGRTLFTGCAGLGVTRWVVGLLAQHGFYPYEPILERIDEKFGG--LPEVPKTLTWPE........................................ 527
11 -45.6004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  12  1......................................................................................................................................MGSSSSGLVPRGSHMNIAVLPN---------SPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAAL-ITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRRE------PSKHLDRLQSFRMREYVCIGTP--DDVSDFRERWMVRAQAIARDLGLTFRVDYASLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG-------EPAHT-GCVAFGMDRLAVAMFHTHGT-DLSAWPAKVRDILGLQPHV.................................................. 330
12 -45.6003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  12  1......................................................................................................................................MGSSSSGLVPRGSHMNIAVLPN---------SPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRRE------PSKHLDRLQSFRMREYVCIGTP--DDVSDFRERWMVRAQAIARDLGLTFRVDYASKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG-------EPAHT-GCVAFGMDRLAVAMFHTHGT-DLSAWPAKVRDILGLQPHV.................................................. 330
13 -35.3002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  13  30...DPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLGEDRIELTLDAIFRLRKQLAEALGKKYKIGIRGIEVESFIIKVPADHELRMLKVPYIKSMENIEGGIQLELEVGEAEMK----NRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQ-------AMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEPGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGG----IHGIERVDEFHRIEIVWIGTK--EEVLKCAEELHDRYMHIFNDILDIEWRKARVTGLAEENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSG-------DELWS-GCSGVGLERWAAVFLAQKGLDPA-NWPEEFRNRVGE...................................................... 508
14 -25.3002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  11  31...................................................................................................................................................................EAEIVSHRLMLRA---------LRQEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRI--------ADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQ----RPRFGVMRGREFLMKDAYSFDVDE-AGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSH----EFIVLAETGESGVYIDRDVLIFYSDSMKANVTGPDGTDAPI----HGGSYGVGVSRLLGAIIEACHDDNGIIWPEAVAPF----TILNLKQGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADL..... 410
15 -24.8004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  14  42......................................................................................................................................................................ADWYSQVITKSEMIEYH---DISGC--YILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTE---LAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAFATM-EEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWG---LTTRTIGVMTMVHGDNMGLVLPPRVACV----QVVIIP-----------CGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRAD 361
16 -24.1004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  1..............................................................................................................................................MGSGEGQGPKKQTRLGEAKKEENLADWYSQVITKSEMIEYH---DISG--CYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTE---LAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEF----KHPQPFLRTREFLWQEGHSAFA-TMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGL---TTRTIGVMTMVHGDNMGLVLPPRVACV----QVVIIP-----------CGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRAD 345
17 -23.5005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  17.........................................................................................................................................................................YIDVITKAEMIEYYDVSGC-----YIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLREKDHIEGFAPEVAWVTRAGDTEL----EQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEF----SHPTPFIRTREFLWQEGHCAWAKA-EECAKEVLEILECYASVYEQLLAVPVVRGRKTEEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGL---STRVIGVMIMVHGDNRGMVMPPRVAST----QVIIIP------------GITKDTTEEARQELLASCWRLESELCEGGVRARCD 333
18 -22.6004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  15  11................................................................................................................................................................KKIENFSDWYTQVIVKSELIEY---YDISGC--YILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLKEKNHIEGFSPEVAWVTKYGDSN----LPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEF----KQPTPFIRTREFLWQEGHTAHKNE-EEAVKLVFDILDLYRRWYEEYLAVPIIKIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQ-----YVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKY----KVVIVP----------------FYKTTDENAIHSYCKDIEKILKNAQINCVYD 330
19 -22.5005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  16  15................................................................................................................................................................DKITSFADWYSQVIVKSEMIEY---YDISGC--YILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLTEKDHVEGFSPEVAWVTKSGKSDL----AEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEF----KHPTPFIRTREFLWQEGHTAHSTR-KEALEMVDIILNEYASIYEDLLATPVVKGTKSEEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKG---NKEYAHQ--TSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPV----QVIIIP----------------IFKTVITEEQKKICNEVECILKKAGVRVKID 334
20 -22.1003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  13  19......................................................................................................................................................................ADWFDAIMDAAELVDRRY--PVKGC--VVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKESDHIKGFEAECFWVEKGGLQP----LEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHET----KNTKPLIRVREIHWNEAHCCHATA-EDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESV-----HPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPI----HVVIIP-----------GCGKKNNQESDQQVLGKVNEIADTLKSKLGLRVSID 337
21 -22.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  15  8......................................................................................................................................................................SEWYSDILEKAEIYDVRYPI----KGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQ---LDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYET----KHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTM-QIATVHNLGQNFSKTFEIIFETPTGDKD-----YAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPI----QVVIVPKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIK.... 335
22 -21.8005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  16  8................................................................................................................................................................KKSTNFADWYTQVIVRGELVEY---YDISG--CYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLKEKDHVEGFKPEVAWVTHYGDSE-----PEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEF----KQPTPFLRTREFLWQEGHTAHATE-EEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQ-----LVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAV----QAVIIP----------------IFKETGGMEIVAKCRELERLLNAAGVRVKVD 327
23 -21.3005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  15  28..........................................................................................................................................................................................YYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLKEKDHVEGFSPEVAWVTHYGDSPL----PEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEF----KQPTPFLRTREFLWQEGHTAHATE-EEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKR-----LVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASV----QVVIIP----------------LFKDENTGEILGKCRELKTMLEKADIRVRID 326
24 -21.1001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  15  18.........................................................................................................................................................................YLEVIQKAELADYG---PVRGT--IVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLKEAEHVEGFSPELAVVTHAGGEE----LEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEM-----RTRPFLRTSEFLWQEGHTAHATR-EEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEEKFAGAVYTTTIEALMKDGKA--QAGTSHYLGENFARAFDIKFQDRDLQVK-----YVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPI----QVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEW.. 339
25 -20.7001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  10  117.................................DDFEQIEKTMKQIVNENMKIERKVVSRDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSN-NKMLQRI---------YGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNS---QLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPMQ-------LDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASG---AVSGLQRVRGMTLNDSHIFVRP--DQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSDFLPERFDLTYIGQDGEHHRPVVIH--RGVVSTMERFVAFLTEETK-----AFPTWLAP----KQVQIIPVNVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQK... 596
26 -20.2004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  2......................................................................................................................................................................ARDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT---------SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGLMRVRGFTQDDAHIFCTE--EQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERKVPVMIH--RAILGSMERFIGILTEEFAGF----FPTWLAP-----VQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRR... 350
27 -20.1001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  15  29...............................................................................................................................................................EKMTEFSEWFH-NILEEAEIIDQRY----PVKGMHVWMPHGFMIRKNTLKI-LRRILDRDHEEVLFPLLVPEDELKEAIHVKGFEDEVYWVTHGGLSK----LQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHT---RPLIRVREITTFKEAHTI-HATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKT--QIGTVHNLGQTFARTFEIKFETPEGDHE-----YVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEEVMEACRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMR.... 362
28 -20.0004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  3...................................................................................................................................................................SSSSGDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF---------EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAM--EQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG-----DIEVWDQAEKQLENSLNEFGEKDFQPIRFNLTYVSHDGDDKKRPIVH--RAILGSVERMIAILTENYGGK----WPFWLSP----RQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQ... 355
29 -19.9004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  2......................................................................................................................................................................ARDHRKIGRDQELYFFHE----LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF---------EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG---ALTGLTRVRRFQQDDAHIFCAM--EQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG-----DIEVWDQAEKQLENSLNEFGEKDFQPIRFNLTYVSHDGDDKKRPIVH--RAILGSVERMIAILTENYGGK----WPFWLSP----RQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQ... 351
30 -19.3003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  12  1................................................................................................................................................MGSSSSGLVPRGSHKNASSATPATMTSMVSQRQDLFMTDP----LSPGSMFFLPNGAKIFNKLIEFMKLQQFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVE------TTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASG---ALSGLTRLRKFHQDDGHIFCTP--SQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTR-DLKVWNHAEQVLKEILEESGKPDFQPERFDLKFKDQDNSYKRPIMIH--RATFGSIERFMALLIDSNEGR----WPFWLNP----YQAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNE 393
31 -19.2002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  12  32.........................................................................................................................................................................................IRQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRL--------KDRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEK----RSRSGLLRGREFIMKDGYSF-HADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDT---EIGHIFKLGTRYSDAMGATVLDENGREKSV----IMGCYGIGVSRLLSAIVEQNADERGINWPTGIAPF----HVVQMNVKDEYQTKLSQEVEAMMTEAGYEVLVDDRNERAGVKFADADL..... 521
32 -19.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  14  18...................................................................................................................................................................ITVKPDSRVPVFNREFATF------TGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLFDIEGHEFAVK-------MNCPYHILLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSG---SIYGLLRVRGFTQDDAHIIVPGGRVIDVEEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTIQFDFNPRRFRLYDVVREEFGIEEVYIH--RALLGSIERFLGVYLEHRRGR----MPFTLAP----IQFAVIAVKTGGEVDRESIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTA... 395
33 -18.6005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  17  34.........................................................................................................................................................................................IRRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRL--------KDRHEREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEI----RPRFGLMRGREFIMKDAYSF-HLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLA---GEDDIVFSDSSDYAANIESEAMKLSVLSEQGKPVNL----IMGCYGIGVSRVVAAAIEQNHDERGILWPSALAPF......................................................... 474
34 -17.9001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  13  238...................................................................................................................................................................EAAKRDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT---------SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGLMRVRGFTQDDAHIFCTE--EQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERKVPVMIH--RAILGSMERFIGILTEEFAGF----FPTWLAP----VQVVIMN-ITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRR... 589
35 -15.2001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  15  9..........................................................................................................................................................................VALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVRDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRGRGLLAYLRPTAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPR----NFIFRVREFEQMEIEYFVRP--GEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFP---GSLELEGIAQRTDFDRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTRE-LKLKPQLAPI----KVAVIPLVKNRPEITEYAKRARLLALGLGRVLYEDTGNIGKAYRRHD...... 385
36 -13.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  21  48..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG---DNDTELSKQIFRVD--------KNFCLRPMLAPNLANYLR-KLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIV.......................................................................................................................................................... 191
37 -12.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  65..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG------------NDTELSKQIFRVDKNFCLRPMLAPNLGNYLR-KLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIV-----ELSSAVVGPRPLD-------REWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL................................................................................... 285
38 -12.1001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  16  126........................................................................................................................................................................................................HALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPPRYFNMMFQDLR--------GPRGGRGLLAYLRPTAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPR----NFIFRVREFEQMEIEYFVRP--GEDEYWHRYWVEERLKWWQEMGLSLVPYQQPPESSAHYAKATVDILYRFP---GSLELEGIAQRTDFDLGS-STQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTRE-LKLKPQLAPI----KVAVIPLVKNRPEITEYAKRARLLALGLGRVLYEDTGNIGKAYRRHD...... 448
39 -12.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  59..............................................................................................................................................................................................................LEREITRFFVDRGFLEIKSPILIPLEYIERMGI-----------NDTELSKQIFRVDKNFCLRPMVAPNIFNYAR-KLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFFQM------GSGCTRENLESIITDFLNHLGIDFKILELSSAVVGPIPLDRFGLERLLKVKHDFKNIKRARSESYYNGISTNL............................................................................................................ 267
40 -11.9003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  18  62..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG------------NDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLVFWQM------GSGCTRENLESIITDFLNHLGIDFKIV.......................................................................................................................................................... 205
41 -11.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  48..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG------------NDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLAFAQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM----------HGDLELSSAVVGPIPLDREWGID--------------KPWIGAGFGLERLLKVAARSESYYNGIST................................................................ 266
42 -10.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  65..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG------------NDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDT----------LDVMHGDLELSSAVVGPIPLDREWGID--------------KPWIGAGFGLERLLKVAARSGSYYNGIST................................................................ 283
43 -10.5004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  65..................................................................................................................................................................................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMG------------NDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE-------HLEEFTMLSFIQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM----------HGDLELSSAVVGPIPLDREWGIDKP----------------GAGFGLERLLKVAARSESYYNGIST................................................................ 283
44 -9.6802zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  88............................................................................................................................................................................................................LELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHP------------SQVFWLDGKKCLRPMLAPNLYTLWR-ELERLWDKPIRIFEIGTCYRKESQGAQ-------HLNEFTMLNLTELGTPLEERH----QRLEDMARWVLEAAGI---------REFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEI-------------------GLGFGLERLLMI-REGTQHVQSMARSLSYLDG......................................................... 296

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.