current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610
# Score Template Links and tools%idFirst MIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAHVMYLELast
1 -205.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model  100  1MIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAHVMYLE 611
2 -181.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  38  8.LVPRGSFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGFIDLRDASGIAQVVFRDPQ-DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQL--DEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARH-DFVEIETPTITRSTPEGARDFLVPARHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVM-------PGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANR-----LGLIDPDAWAFVWVVDPPLFEPVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA......... 610
3 -176.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  39  1........MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGFIDLRDASGVSQVVFREG----DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQL--DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEH-DFVEIETPTLTRSTPEGARDFLVPARQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVM-------PGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIA-----KRLDLIDPNAWAFTWVVDFPMFEAADVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKS.... 596
4 -175.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  39  15......SMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGFIDLRDASGVSQVVFREG----DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQL--DEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEH-DFVEIETPTLTRSTPEGARDFLVPARQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGA-------VVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKR-----LDLIDPNAWAFTWVVDFPMFEAADVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKS.... 612
5 -170.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  39  2.......GMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGFLDVRDREGLAQVVFDPDR--AETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDN-GFLDVETPILGRPTPEGARDYLVPSRYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPANDPKGRVAALRV-PGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNEREGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDL------KLLTREWAPMWVVDFPMFEENDD---GSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE.......... 593
6 -168.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  40  2..........RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGFIDMRDREGIVQVFFDPDR--ADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDS--NHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDH-GFLDIETPMLTKATPEGARDYLVPSRHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRVAALRV-PGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNELEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVG-----KDLGLTDESKWAPLWVIDFPMF--EDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN.......... 590
7 -162.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  43  1........MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGFLDLRDREGLVQLVAHPA---SPAYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEAKTPPFPVEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDRE-GFVQVETPFLTKSTPEGARDFLVPYREPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALAL--------PKALSRKEVAELEEVAKRHKAQGLAWARVEEG--GFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLK------REGFRFLWVVDFPLLEWDE-EEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP.............. 580
8 -120.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  16  23.HNPWPHKFNVSITVPEFIAKYSDDIVSVAGRVLSKRSSSFIDLHDSQTKLQIMLNKSAYEEDFVSLTKMIYRGDICGFTGHP---------TRTKTGELSLIPISGMILSPCLH-MLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDK-GFLEVETPILTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKD-----------ITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEALTF-------------------------KQAIRFNAICAEPQTTARVMDKLFGDLIEVD-LVQPTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEKGGKKVVKPKA.... 600
9 -89.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  26.INPYPHKFHVSISLADFIAKYNDIVQSVAGRVFSKRESGFYDLHGEGTRLQVLANARFHDEAFDNLHDRIKRGDIIGVNGYPA---------RSKSGELSIIPYEIIQLTPCLH-MLPHTHFGLKNQETRYRMRYLDLINPDVKNRFVTRSRMISFLRRYLDNL-GFLEVETPMMLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH----PNGIVENPVYEVDFTPPFRKVNIYDGLQEK----------------------------------------------------------------------------------------LGIQFPPADTLDTDEANKFFDKLAVENNVECPAPRTTARL--------LIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA........................... 524
10 -89.6003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  19  24.EDPYPHKFHVDISLTDFIQKYTDITLKVAGRIHAKRASGFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPG---------KTKKGELSIIPYEITLLSPCLH-MLPHLHFGLKDKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDEL-GFLEIETPMMIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKA----------------------------------------------------------------------------------------LGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARL--------LVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDK...................................... 510
11 -89.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  19  33.RPFYPHKFKISMSLPAYALKYKDTTLSLSGRVTSIRSSSFYDIFCEEQKVQIIANIMEHDGEFSVSHSEIRRGDVVGFTGFPG---------KSKRGELSLFSKSVVLLSPCYH-MLPTAISGLKDQEVRYRQRYLDLMNEESRKVFKLRSRAIKYIRNYFDRL-GFLEVETPMLMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHPDGPEGKCIEIDFTTPWKRFSF-----------------------------------------------------------------------VEEIESGLGEKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKL-----------------------------AGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG............................ 528
12 -87.9003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  23  24.VDPFGKRFERTHKAEELFELYQQIEVAVAGRIMTKRGMGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLGDIVGVRGTMF---------KTKVGELSIKVSSYEFLTKALR-PLPEKYHGLKDIEQRYRQRYLDLINPESKKTFITRSLIIQSMRRYLDSH-GYLEVETPMMAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLV------------DLTPEWRRLHMVDA----------------------------------------------------------------------IKEYVGVDFWRQMSDEEARELAKEHGVEVAPHMTFGHIVNEF-----------------------------FEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRH......................................... 492
13 -87.6004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  22  48MIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGFLVLRQQQFNVQALVAVGDHSKQMVKFAANINKESIVDVEGVVRKVNQKI--GSCTQQDVELHVQKIYVISLAEPLPLQLDDRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINK-GFVEIQTPKIISAASEGANVFTVSYFKNNAY--LAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLR--LEYCEALAMLREAG-------------------------------------------------VEMGDEDDLSTPNEKLLGHLVKEKYDT------------------------------------------------DFYILDKYPL-------------AVRPF--------YTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK-IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKR------TP................................ 515
14 -86.8004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  49..IAYPNDFQPTHHAADLQTAYKSLEVAIAGRMMLKRVMGFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLF---------RTNKGELSVKCTQLRLLAKALR-PLPDKFHGLADQETRYRQRYVDLITPETRTTFRARTKAIASIRKFMGDA-DFMEVETPMLPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQ------------YQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLAL----------------------------------------------------------------------------------------------FEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED....................................... 523
15 -86.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  21  33..VAFPNDFRRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGFVTLQDVGGRIQLYVARDSLPEGVYNDQKKWDLGDIIGARGTLF---------KTQTGELSIHCTELRLLTKALR-PLPDKFHGLQDQEVRYRQRYLDLINDKSRQTFVVRSKILAAIRQFMVAR-GFMEVETPMMVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVF------------DFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTE--------------------------------------------------------------------------------------------------IFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK....................................... 504
16 -86.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  25  1........MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLG-------FEILPEKIVVLNRAETLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHEN-GFIEIHTPKIIATATEGTELFPMKY---EEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHPKLPFPRVSYDKALEILGDLGKEIPWGEDID---------------------------------------------------------------------------------------------------------------------TEGERLLGKYMMENENAPLYFLYQYPS---------------------EAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES-FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP..................................... 438
17 -85.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  33..IAFPNDFRRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGFVTLQDVGGRIQLYVARDDLPEGVYNEQKKWDLGDILGAKGKLF---------KTKTGELSIHCTELRLLTKALR-PLPDKFHGLQDQEARYRQRYLDLINDESRNTFKVRSQILSGIRQFMVNR-GFMEVETPMMVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTL------------DFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTE--------------------------------------------------------------------------------------------------IFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK....................................... 504
18 -85.7004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  17  24.INPYPHKFERTISIPEFIEKYEDTILNITGRIMRVSASGFFDLVGDGEKIQVLANYSFHNHEFAECYDKIRRGDIVGIVGFPG---------KSKKGELSIFPKETILLSACLH-MLPMKYG-LKDTEIRYRQRYLDLLNESSRHTFVTRTKIINFLRNFLNER-GFFEVETPMMLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTY-----KISYNKDGPENQPIEIDFTPPYPKVSIVEEIE------------------------------------------------------------------KVTNTILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKY----------------------------NDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN....................................... 508
19 -85.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  20  32.RQPYPVDVPRTHTLLEIRQAYTGEIVGVTGRVVFARNSGFATLQEGDGQLQAMISLAEVGQEALDNWTYVDIGDIVFVHGEVI---------TSKRGELSVLADSWQMAAKALR-PLPVAHKEM-SEESRVRQRYVDLIRDQARKVARQRIAVMRAIRSALERR-GFLEVETPMLTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQ-----------VPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAE----------------------------------------------------------------------------------------------TLWAIADRLGLDIPRDRGYGHGKLVE----LWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKP......................................... 501
20 -85.3005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  21  29.YDPYPVAIERTHTLAEIRATYTEDIVGVAGRVVFARNTGFATLQDGDGQLQAMISLDEVGRESLDRWADVDIGDVVYVHGTVI---------SSRRGELSVLADSWRMAAKALR-PLPVAHKEM-SEESRVRQRYVDLIRPQAREVARQRIAVIRAVRNALERR-GFLEVETPMLTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGDIDGEWATMEMYSSLSEA-----QITPETTVARLRDIASGLDVEIDNSVFGHGKLVEEL-----------------------------------------------------------------------------------------------------------------------WEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN...................................... 500
21 -84.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  10.KLPLIQSRDSDRTGQKRVKKDSDKEVLFRARVHNTRQQGFLTLRQQASLIQGLVKANTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISETPELPILLEDLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATK-KFTEVHTPKLLGAPSEGSSVFEV--TYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKE-------------------------------------------------IGDFEDLSTENEKFLGKLVRDKYDT------------------------------------------------DFYILDKFPL---------------------EIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP..................................... 490
22 -84.3006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  92.EDPYPHKFHVDISLTDFIQKYTDITLKVAGRIHAKRASGFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPG---------KTKKGELSIIPYEITLLSPCLH-MLPHLHFGLKDKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDEL-GFLEIETPMMIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKA----------------------------------------------------------------------------------------LGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARL--------LVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV................... 597
23 -83.8001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  28  1........MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGFIILRDKTGLGQVVVDKN---SSAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKAKALPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKE-GFIEIFTPKIIASATEGGAQ-LFPVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT-------------------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPS---------------------DARPFYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES-FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP..................................... 429
24 -81.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  21  5MMTEATTTPVETPIVCNIRDGLEGKLVTFKGWAYHIRKARFVELRDGSGYCQCVIFGKELCEP--EKVKLLTRECSLEITGRLNAYAGKNHPPEIADLNLEMQVTEWKVIGESPI-DLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDN-HFTEIQPPTIVKTQCEGGSTFKLQY---NEPAYLTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVPTRPFKRMTYADAIKYCNDHGILNKDK---------------------------------------------------------------------------------------------------------------------PFEYGEDISEKPERQMTDEIGCPIFMIHFP-------------SKMKAF--------YMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP-YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP..................................... 456
25 -80.9001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  21  1........MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGFLWIRDSTGIVQAVVAKNVVGEETFEKAKKLGRESSVIVEGIVKADER-------APGGAEVHVEKLEVIQAVSEFPIPE-NPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKD-GWHEVFPPILVTGAVEGGAT-LFKLKYFDKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFD--------------------------------------------------------------------------------------------------------------------------RPFFVYGYP-------------KHIKAF--------YMKEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD-YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP..................................... 434
26 -79.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  22  21.IKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGFLVLRDGTGYLQCVLADELCQCY---NGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDR-GYYEVTPPTLVQTQVEGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPKRPFKRMNYSDAIVWLKEHDVKKEDGTFY--------------------------------------------------------------------------------------------------------------------EFGEDIPEAPERLMTDTINEPILLCRFP-------------VEIKSF--------YMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP-YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQ......................................... 462
27 -76.8002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  23  9...................VKHRNERVCIKGWIHRMRRQGFFILRDGTGFLQVLLMDKLCQTY---DALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNA-GYVEVAPPTLVQTQVEGSTLFNLDY---GEQSFLTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPERPFLRMEYKDAIKWLQEHNVENEFGNTF--------------------------------------------------------------------------------------------------------------------TYGEDIAEAAERFMTDTINKPILLNRFP-------------SEIKAF---------MQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP-YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVG......................................... 433
28 -76.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  34.VMPMHQSQPCYKTIEELVPAMAEKTVTIRARVQAVRGKGFLFLRKGIYTCQALVMKSETSKEFVQFCQKISAESICDITGIVKAVEKPI--EKATQQDVEIHVTSIAVVSLAEYEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQ-KFVEIHTPKLIGCSSEGSNIFEVKY---DRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRIYRPFLRLTYKEAIEMLRASGETIGDYDDF----------------------------------------------------------------------------------------------------------------------TPQEVKLGELIKAKYNTDFYILDKFP-------------AAIRPF---------TMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT-LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP..................................... 548
29 -75.5001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  27  9...................KAHVGQEVELLGFLHWRRDLGFLLLRDRSGVVQVVTGGL----------KLPLPESALRVRGLVVENAK-------APGGLEVQAKEVEVLSPALETPVEIKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQ-DFTEIFTPKVVRAGAEGGSG-LFGVDYFEKRAYLAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEY----------------------------------------------------------------------------------------------------------------------AKERWGSDWLFVTRYPR-----------------------SVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA-FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP..................................... 422
30 -63.8003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  1..........................................................................................................................MGSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADR-GVLEVETPCMSQATVTDIVPFETPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCP------AAESLSYQQAFLRYLEIDP---LSADKTQLREVAAKLDLSNVADTEEDRDTLLQL--------------------------------------------------------------------------------------------------------------------LFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA......................................... 339
31 -59.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  20  9...........................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADR-GVLEVETPCMSQATVTDIFPFETPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------QPAESLSYQQAFQRHLEIDP---LSADKTQLREAAAKLDLSNIADTEEDRDTLLQL--------------------------------------------------------------------------------------------------------------------LFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA......................................... 326
32 -59.1003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  20  2......................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDR-GFKWLLPIMLSPITPDPAGEGIRPAEVDGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEPRARHFKVYDYKDILEEFGSDEKASME-------------------------------------------------------------------------------------------------------------------------------------------EPFWIVNIPREFYDREENG-------------------------VWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS-FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI.................................... 294
33 -55.4001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  20  2......................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKE-GFKWLLPVIISPITPDPAGE-PAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEPKTKRFEVFEYSEVLEEFGSDEKA-----------------------------------------------------------------------------------------------------------------------------------------SQEMEEPFWIINIPREFYDREVDG-------------------------FWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS-FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI.................................... 294
34 -43.90011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  15  1...............................................................................................................................................MKTAYIAKQRQISFVKSHLEERLGLIEVQAPILSRVGDGTQDNLVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFL-------PDQIHFVHSQELLSRYPDLDAKGRERAIA----------------------------------------------------------------------------------------------------------------KDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT-GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVRE........................................ 324
35 -43.1004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  4.....................................................................................................................................DGYSSYV-LLQEQILTVKRSFSEALEKEL----NLVEVRAPILFRVGDGTQDNLVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPIL-------PETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARA-------------------------------------------------------------------------------------------------------PDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLDSLEVSSMGIRVNAEALRHQISLT-GDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL................................... 351
36 -40.4005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  31  1....MAVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGFIDLRDKSGLVQLVCDPS---SKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 109
37 -38.0004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  21  2.......SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGIVKVSDREGGAAVPVYLERTPDHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKAKPLPID............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 113
38 -36.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  3................................................................SSSSGLVPRGSHMFLTRRDPPLSSFTKVQYQRLKELNASGEQLEMGFSDAL-SRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKAL-HQQGFVQVVTPTIAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAG------IREFELVTESSVVYGDTVDVM.......................................................................................................................................................................................................................................................................................................................... 238
39 -36.1004gla_C mol:protein length:109 OBody NL8  ali model follow..  21  2.....SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGIVKVSDREGGAAVPVEAGKTPDHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKAKA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 109
40 -35.7004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  23  4.....SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGIVKVSDREGGAAVSVYLEKTPDHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKAK................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 113
41 -35.7004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  19  1.....AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGIVKVSDREGGAAVPVYLEKTPDHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 108
42 -35.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  19  2.......SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGIVKVSDREGGAAVPVYLERTPDHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 107
43 -24.3004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  3................................................................SSSSGLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLNS----GKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 201
44 -24.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  14  7....................................................................GLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLNSGKPF----RELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 201
45 -22.9004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  7....................................................................GLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLNSGKPF----RELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 201
46 -19.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  6....................................................................................................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYEERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 184
47 -19.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  5....................................................................................................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYEERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQM-CTRENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 183
48 -19.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  3...............................................................................GGLVPRGSHGASATKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK------DLQQIYAEERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRLTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 198
49 -16.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  6....................................................................................................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKDLQQIYAEERENYLGKLEREITRFFVDR-GFLEIKSPILERMGIDNDTELSKQIFRVDKNFCLRLAPNLANYLRKLD---KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL.......................................................................................................................................................................................................................................................................................................................................................... 184
50 -14.1001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  23  18....FQGPNGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNG------VTVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
51 -13.4002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  10  1....................................................................................MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRNDRDYILPTHEETFTELIRDEINSYKRLPL-----NLYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRD-YEKAYSRIFERCGLEFRAII-GDGGAMGGKDSKEFM-------AISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQ---LANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG-------------HIFKLGTRYSDAMGATVLDENGREKSVIMGYGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVLVDDRNERAGVKFADAD 520
52 -12.8005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  13  1..................................................................................MAMRTSQYLLSTLKETPADAVVISHQLLLRAGMIRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDRHEREFCVPTHEEVITDLARNELNSYKQLPI-----NFYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDG-MYQAYSKIFSRLGLDFRPVQ-ADNGSIGGSGSHEFH-------VLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRGDHELNEIKAVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGANIEDKHYFGVNWERDLPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVG-------------HIFQLGTKYSEAMKLSVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESELTAAGFEVLLDDRDKKTSPGVKFAD 523
53 -10.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  15.............................................................................................................................SMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTA-RKFGFEEYDSPVL-KAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKME--------------------------------------------------------KLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIF-----------------------DASVVRGLAYYTGIV------------------FEGFDRDGNFGGG-----------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSI------RRLRDAGRSADIVFDKKKVVQAFNYAD 402
54 -9.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  1..........................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVY-ESYGFTPIETPAVERLPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRFRQFRQCDIDVSLLYDAQMPAIITEIFEAV--NIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCI-------------------------------------------------------------------DLAIARGLNYYTGTV------------------YETTLIGHEICSGG----------------------RYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKV-----SQQLRQAGLNVITNFEKRQLGKQFQAAD 418
55 -9.5603kf6_A mol:protein length:159 Protein stn1  ali model follow..  16  48........................RWIQIVGYIAAIDIYEVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKI----------NSFRSEVELIAQSFEELRDPNDEWKA--------KRMRYKKNLTKISKN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
56 -9.5304g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  17.............................................................................ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLK------AQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCF-KRHGAEVIDTPTLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDFDI------------------------------------------AGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDK------------------------LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVA-----AGG-----------------------RYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSREEVDVRREDL. 505
57 -9.0103hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  17...............................................................................................................................QKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATA-KTFGFEEYDAPVL-KAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVE--------------------------------------------------------AQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLF-----------------------DASVVRGLAYYTGIV------------------FEGFDREGKFGGG-----------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDDVVIPFDESMRPHALAV-----LRRLRDAGRSADIILDKKKVVQAFNYAD 402

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.