current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4apv_A mol:protein length:112 PRIMOSOMAL REPLICATION PROTEIN N, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MTNRLELSGIICRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGDLELast
1 -70.1004apv_A mol:protein length:112 PRIMOSOMAL REPLICATION PROTEIN N  ali model  100  1MTNRLELSGIICRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGDLE 106
2 -68.1005wqv_A mol:protein length:104 Primosomal replication protein N  ali model follow..  91  1MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVAGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD.. 104
3 -66.3002pnh_A mol:protein length:107 Primosomal replication protein n  ali model follow..  91  4MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEAAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD.. 107
4 -65.4001v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  89  18MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKL 123
5 -59.5003fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  24  1.MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLAD-TPLGTEMQVQGFLAPARKDSV--KVKLHLQQARRIAGSMGR 102
6 -57.1003k8a_A mol:protein length:103 Putative primosomal replication protein  ali model follow..  25  6FTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQ--YRQGDCATVEGFLAQKSRRSL--MPMLRIQNIKEYKG.... 103
7 -55.6004fdb_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  21  2.INRLQLVATLVEREVMRYTPAGVPIVNCLLSYSGQAMEAQTARQVEFSIEALGAGKMASVL-DRIAPGTVLDCVGFLARKHRSSK--ALVFHISGLE........ 95
8 -55.6003en2_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  21  2.INRLQLVATLVEREVMRYTPAGVPIVNCLLSYSGQAMEAQAARQVEFSIEALGAGKMASVL-DRIAPGTVLECVGFLARKHRSSK--ALVFHISGLE........ 95
9 -50.6005yyu_A mol:protein length:112 Single-stranded DNA-binding protein  ali model follow..  19  1MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREAD-FINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQTEVVADSVQFLEPK... 106
10 -50.3005xgt_A mol:protein length:111 Single-stranded DNA-binding protein  ali model follow..  18  1MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREAD-FINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRTEVVCDSVQFLEP.... 105
11 -50.2002vw9_A mol:protein length:134 SINGLE-STRANDED DNA BINDING PROTEIN  ali model follow..  17  1MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKHTITADSLQFMDKKSDN 111
12 -50.1003vdy_A mol:protein length:116 Single-stranded DNA-binding protein ssbB  ali model follow..  16  4MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIE-ADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVTEVLADTVRFMDPKPRE 112
13 -48.0001z9f_A mol:protein length:153 Single-strand binding protein  ali model follow..  19  9FFNKIILIGRLVRDPEERYTLSGTPVTTFTIAVDRVPRKAPDDAQTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRWETPTGEPEVVANVVRFMDRKPAE 119
14 -43.9003tqy_A mol:protein length:158 Single-stranded DNA-binding protein  ali model follow..  13  8.VNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRDTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVTEIIANEMHMLDNRGGG 118
15 -43.7005yun_A mol:protein length:121 Single-stranded DNA-binding protein  ali model follow..  16  5.VNKVILVGNVGGDPETRYMPNGNAVTNITLATSESWKDTGQQQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQTEIVVDNMQLLGGR... 115
16 -43.3002cwa_A mol:protein length:263 Single-strand binding protein  ali model follow..  19  5.LNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLLSNGGEREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQWERRRSELQIRADFLDPLDDRGKE 113
17 -42.3003koj_A mol:protein length:108 uncharacterized protein ycf41  ali model follow..  12  5.MNSCILQATVVEAPQLRYAQDNTPVAEMVVQFPGLSSK-----DAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSLLKPDGNTELTVTRVHH....... 102
18 -42.1005odn_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  18  27.VNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTDDGNEVQNTEWHDVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTEVKAQEMMFLDSNRQG 136
19 -42.1002fxq_A mol:protein length:264 Single-strand binding protein  ali model follow..  19  5.LNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKKKSEVQVRAEFIDPLEGRGRE 113
20 -42.0005odp_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  18  27.VNKVILIGNLGDKPELRYTGSGTAVCNMSLATNETYTDDGNEVQNTEWHDVVAWGRLGEICNEYLKKGSQVYFEGKLQTRSWEDRDNNTEVKAQEMMFLDSNRQG 136
21 -41.6002dud_A mol:protein length:133 Single-stranded DNA-binding protein  ali model follow..  16  15.LNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSLGDVSQKTTWHRISVFPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVTTIIADNIIFLSDQTKE 131
22 -40.8002ihf_A mol:protein length:239 Single-stranded DNA-binding protein  ali model follow..  19  5.LNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKKKSEVQVRAEFIDPLEGRGRE 113
23 -40.6001eqq_A mol:protein length:178 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  14  6.VNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDTGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQTEVVVNVGGTMQMLGGR 116
24 -39.5003ulp_A mol:protein length:124 Single-strand binding protein  ali model follow..  14  6.LNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRNTNELKSKTDWHRIVVYDQIVDLIDKYLRKGRRVYVQGSLHTRKWHTPKQITEIILSDLIFLDDKRNF 123
25 -38.9006cqk_A mol:protein length:119 SsDNA-binding protein essential for mitochondrial genome maintenance  ali model follow..  10  3.FSKMSIVGRIGSEFTEHTSANNNRYLKYSIASQPRRDGQ------TNWYNITVFNEQINFLTEYVRKGALVYVEADAANYVFERDDGSLSLVQKDINLLKNGKKL 106
26 -38.5004gs3_A mol:protein length:107 Single-stranded DNA-binding protein  ali model follow..  18  11.NNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKD-------YLPITISNRLFEGM--NLEVGTRVKIEGQLRSYNRKSPEEILTVFARDISVVPE.... 107
27 -37.7002hql_A mol:protein length:110 Hypothetical protein MG376 homolog  ali model follow..  12  7MLNRVFLEGEIESSC----WSVKKTGFLVTIKQMRFFGE----RLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERSEIWKTTIEIVKIFNPKNEIVI 105
28 -37.5003lgj_A mol:protein length:169 Single-stranded DNA-binding protein  ali model follow..  16  16MLNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFESYMNTHQKVEKTEWHSVVVFNPFAKIALQYLHKGSKVYIEGKLQTRKWQDKNGHTEIVLPQLHLLDAKKEQ 132
29 -37.4001se8_A mol:protein length:301 Single-strand binding protein  ali model follow..  17  5.MNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGDGRERNLPWYHRVSILGKPAEWQARNLKGGDAVVVEGTLEYRQWEAPEGGVNVKALRMEQLGTQPEL 115
30 -35.8003pgz_A mol:protein length:193 Single-stranded DNA-binding protein  ali model follow..  11  20.LNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRDTNERKERTEWHNIVIFNELVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNTEIVLQKLQMLDGRAAA 135
31 -35.0001x3e_A mol:protein length:165 Single-strand binding protein  ali model follow..  15  4.DTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEVEVEVDEI......... 106
32 -34.7001ue1_A mol:protein length:164 Single-strand binding protein  ali model follow..  14  4.DTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEIEVEVDEI......... 106
33 -34.0003afp_A mol:protein length:168 Single-stranded DNA-binding protein  ali model follow..  13  4.DTTITIVGNLTADPELRFTSSGAAVVNFTVASTPRIYDRQSGEGEALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEVEVEVDEI......... 106
34 -31.3004dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model follow..  14  3.GSNALMIGRIADVQH--GFLGAMTVTQYVLEVDG----GASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGY. 100
35 -31.1003eiv_A mol:protein length:199 Single-stranded DNA-binding protein 2  ali model follow..  12  5..TVITVVGNLVDDPELRFTPSGAAVAKFRVASTPRTFDRQTNEGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSYEDREGVYELDVDEV......... 106
36 -29.0003k7u_C mol:protein length:148 MP18 RNA editing complex protein  ali model follow..  13  5SVNSVTLVGVV-HDIQSGFV-YEDAVTQFTLTTTSIDHPTQEVVVEKDHHTIRCFGEFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNVQPPHGQVAVIHGDRRT 120
37 -28.8004dam_A mol:protein length:128 Single-stranded DNA-binding protein 1  ali model follow..  16  10..IMICAVGNVATTPVFRDLANG-PSVRFRLAVTARYWDREKNAGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVRERTSADIDAVAI......... 109
38 -28.1003k81_C mol:protein length:164 MP18 RNA editing complex protein  ali model follow..  13  21SVNSVTLVGVV-HDIQSGFV-YEDAVTQFTLTTTSIDTTTQEVVVEKDHHTIRCFGEFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNVQPPHGQVAVIHGDRRT 136
39 -28.1003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  12  43CVNHCVMLGVV-QNIQEGFV-FEDKVLQFTLITDFEGPSPGDPDKD--FHTVRVFDDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGS. 144
40 -27.9002wkc_A mol:protein length:119 ORF34P2  ali model follow..  10  2........................TIITVTAQANEKNTAKGDKKIIKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYPTVEKVFITNDNSSQSQ 98
41 -27.3005gqo_A mol:protein length:190 Single-stranded DNA-binding protein  ali model follow..  13  20..TPFTVVGNIITNPV-RLRFGDQELYKFRVASNSRRRSPEGTPGNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYEDREGVVEVRATAV......... 119
42 -26.5002wkd_A mol:protein length:119 ORF34P2  ali model follow..  12  2........................TIITVTAQANEKNTRTSTAKGDKKIISVPLFEKEKGSNVDFIQMGDTVTVSGRVQAKESGEYVNYPTVEKVFITNDNSSQSQ 98
43 -25.9004dni_A mol:protein length:257 Fusion protein of RNA-editing complex proteins MP42 and MP18  ali model follow..  11  30.VNHCVMLGVV-QNIQEGFV-FEDKVLQFTLITDFEGP--SPGDPDKDFHTVRVFDSYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMR................. 114
44 -10.3004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  36.IKQVDVLGTVIGVRERDGVDDSTGVINCICLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRT------REEREIHATTYYKVDDPVWN 143
45 -9.2904gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  19..SEVVVAGWVAHLGDY----GRVKIVKV--------SDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKP. 109
46 -9.0404gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  20..SEVVVAGWVAHLGDY----GRVKIVKV--------SDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA... 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.