current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4c3s_A mol:protein length:445 ALDEHYDE DEHYDROGENASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst MGQLTQTNKTELGVFDDMNQAIEAAKEAQLVVKKMSMDQREKIISAIRKKTIEHAETLARMAVEETGMGNVGHKILKHQLVAEKTPGTEDITTTAWSGDRGLTLVEMGPFGVIGAITPCTNPSETIICNTIGMLAGGNTVVFNPHPAAIKTSNFAVQLINEASLSAGGPVNIACSVRKPTLDSSKIMMSHQDIPLIAATGGPGVVTAVLQSGKRGIGAGAGNPPVLVDETADIRKAAEDIINGCTFDNNLPCIAEKEVVAIDAIANELMNYMVKEQGCYAITKEQQEKLTNLVITPKGLNRNCVGKDARTLLGMIGIDVPSNIRCIIFEGEKEHPLISEELMMPILGIVRAKSFDDAVEKAVWLEHGNRHSAHIHSKNVDRITTYAKAIDTAILVKNAPSYAAIGFGGEGFCTFTIASRTGEGLTSASTFTKRRRCVMSDSLCIRLast
1 -123.0004c3s_A mol:protein length:445 ALDEHYDE DEHYDROGENASE  ali model  100  1MGQLTQTNKTELGVFDDMNQAIEAAKEAQLVVKKMSMDQREKIISAIRKKTIEHAETLARMAVEETGMGNVGHKILKHQLVAEKTPGTEDITTTAWSGDRGLTLVEMGPFGVIGAITPCTNPSETIICNTIGMLAGGNTVVFNPHPAAIKTSNFAVQLINEASLSAGGPVNIACSVRKPTLDSSKIMMSHQDIPLIAATGGPGVVTAVLQSGKRGIGAGAGNPPVLVDETADIRKAAEDIINGCTFDNNLPCIAEKEVVAIDAIANELMNYMVKEQGCYAITKEQQEKLTNLVITPKGLNRNCVGKDARTLLGMIGIDVPSNIRCIIFEGEKEHPLISEELMMPILGIVRAKSFDDAVEKAVWLEHGNRHSAHIHSKNVDRITTYAKAIDTAILVKNAPSYAAIGFGGEGFCTFTIASRTGEGLTSASTFTKRRRCVMSDSLCIR 445
2 -99.2005j78_A mol:protein length:488 Acetaldehyde dehydrogenase (Acetylating)  ali model follow..  28  14.HMASMLRDIDLQSIQEVRNYLEEAKAAQKILEKMTQSEIDKIVESMANAAREEAGRLAAMAVEETGFGNVEDKTLKNLFAANDVYN-VKTVGIIRRDEENRVWEIAQPVGIVAGIIPSTNPTSTVIFKALIAVKARNAIVFSPHPSAAKCTAEAARIMQEAAERAGAPKGLISCITQPTMAATNELMKHKLTDVILATGGPGLVKAAYSSGKPAYGVGPGNVPVYIHESANIAKAVQLIIQSKTFDYGTICASEQALLVDESIKEKVVAELKQQ-GAYFLNEEEKQKVASIIMVNGSLNAKIVGKAPQVIAEMAGIEIPSDVKLLVAEETEKEYPFSIEKLSPILAFYIVKGMEEASELAQKLVGGLGHTVGIHAEDEKVIEAYTIDKPAGRIVVNAGTFGGIGATVNVKPSLTLGCGAIGNNITSDNVTVTHLFNIK...... 458
3 -97.8003k9d_A mol:protein length:464 ALDEHYDE DEHYDROGENASE  ali model follow..  27  2.....SLEDKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIADAGYGAREKLAKMAHEETGFGIWQDKVIKNVFASKHVYNYIKDMKTIKEDNEKKVMEVAVPLGVVAGLIPSTNPTSTVIYKTLISIKAGNSIVFSPHPNALKAILETVRIISEAAEKAGCPKGAISCMTVPTIQGTDQLMKHKDTAVILATGGSAMVKAAYSSGTPAIGVGPGNGPAFIERSANIPRAVKHILDSKTFDNGTICASEQSVVVERVNKEAVIAEFRKQ-GAHFLSDAEAVQLGKFILRPNSMNPAIVGKSVQHIANLAGLTVPADARVLIAEETGAKIPYSREKLAPILAFYTAETWQEACELSMDILYGAGHTLIIHSEDKEIIREFALKKPVSRLLVNTPGLGGIGATTNLVPALTLGCGAVGGSSSSDNIGPENLFNIR...... 443
4 -96.5003my7_A mol:protein length:452 Alcohol dehydrogenase/acetaldehyde dehydrogenase  ali model follow..  30  1.........MPVTNMAELDAMIARVKKAQEEFATYSQEQVDKIFRAASLAANQARIPLAQQAVEESGMGIVEDKVIKNHFASEFIYNKEQTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTAIFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNALMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTFDNGVVCASEQAVIVVDEVYDEVKERFASH-KAHVLSKTDADKVRKVLLIDGALNAKIVGQPATAIAEMAGVKVPADTKVLIGEG-SYDDAFAHEKLSPTLGMFRADNFEDAVAQAVTMVEGIGHTSGLYTNQADRIRYFGDKMKTARILINIPTTHG-GIGDLYNFNVTLGCGSWGGNSISENVGPKHLINKK...... 443
5 -95.4005jfl_A mol:protein length:524 Aldehyde dehydrogenase  ali model follow..  52  79..AATSSAAVSDGVFETMDAAVEAAALAQQQYLLCSMSDRARFVQGIRDVIQDTLEKMSRMAVEETGMGNYEHKLIKNRLAGEKTPGIEDLTTDAFSGDNGLTLVEYSPFGVIGAITPTTNPTETIVCNSIGMLAAGNSVVFSPHPRARQVSLLLVRLINQKLAALGAPENLVVTVEKPSIENTNAMMAHPKVRMLVATGGPAIVKAVLSTGKKAIGAGAGNPPVVVDETANIEKAACDIVNGCSFDNNLPCVAEKEIIAVAQIADYLIFNLKKNGAYEIKDPAVLQQLQDLVLTAKGPQTKCVGKSAVWLLSQIGISVDASIKIILMEVPREHPFVQEELMMPILPLVRVETVDDAIDLAIEVEHDNRHTAIMHSTDVRKLTKMAKLIQTTIFVKNGPSYAGLGAGGEGYSTFTIAGPTGEGLTSAKSFARRRKCVMVEALNIR 524
6 -83.7003pqa_A mol:protein length:486 Lactaldehyde dehydrogenase  ali model follow..  19  20.YSLEVIKKIPALSREEAKEAIDTAEKYKEVMKNLPITKRYNILMNIAKQIKEKKEELAKILAIDAGKVEVERSIGTFKLAAFYVKEHRDEVIPS---DDRLIFTRREPVGIVGAITPFNFPLNLSAHKIAPAIATGNVIVHHPSSKAPLVCIELAKIIENALKKYNVPLGVYNLLTGAGEVVGDEIVVNEKVNMISFTGSSKVGELITKKAKKIALELGGVNPNIVLKDADLNKAVNALIKGSFIYAGQVCISVGMILVDESIADKFIEMFVNKAKVLNVGNPLDEKTVGPLISVEHAEWKAIDEGGKLLLG--GKRDKALFYPTILEVDRDNILCKTETFAPVIPIIRTNE-EEMIDIANSTEYGL--HSAIFTNDINKSLKFAENLEFGGVVINDSSLDNMPFGGVKKSGLGREG----VKYAMEEMSNIKTIIISKAEN.. 467
7 -80.4004k57_A mol:protein length:518 Delta-1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  17  62.APSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSALLLKAAALMRRRKRELEATLVYEVGKADVAEAIDFIEYYARAALRYRYPAVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGMIMGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEA----GFPPGVVNFLPGVGEEVGAYLVEHPRTRFINFTGSLEVGLKIYEAAKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKEIGKNEGQLVLGGKRLEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGL--TGGVYSRKREHLEWARREFHVGNLYFNRKITGALPFGGFKLSGTNAKTG---ALDYLRLFLEMKAVAER...... 517
8 -80.1006dbb_A mol:protein length:511 Putative aldehyde dehydrogenase family protein  ali model follow..  18  30.LDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKGEVQEMIDICDFAVGLSRQLYGLTIASERPGH-RMMETWHPIGVCGVISAFNFPVAVWAWNAALAFVCGDSVVWKPSEKTPLTAIACHVLLQKALRPGVAPAELGQLVLG-MRDVGEVLTASKKVPVVSATGSVRMGQEVAKVLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTVGPLVDRASFDADAREQGGEVKGGERGHADAYYVRPAIVRMPKQSAVVERETFAPILYVMVYDNFDDAIDVHNAVPQGL--SSAIFTNDMREAEQFAAGSDCGIVNVNIGTSGAGAFGGEKETGGGRES----GSDAWKAYMRRATNTINYSRQLP 496
9 -79.3003qan_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase 1  ali model follow..  19  61..KDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKADTAEAIDFLEYYARQMIELNRGKEILSRPGE-QNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFVEVLEDA----GLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNMGPVIDEKAFEKEIGKKEGRLMTGGEGDTGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGL--TGAVITRNRAHIEQAKREFHVGNLYFNRNCTGAIPFGGFKMSGTDSKAG---GPDYLALHMQAKTVSEMYAEN.. 519
10 -79.1004v6h_A mol:protein length:484 Succinate-semialdehyde dehydrogenase (NADP+)  ali model follow..  17  36.ATGESLGTVPKMGAAETARAIEAAQAAWAGWRMKTAKERAAILRRWFDLVIANSDDLALILTTEQGKGEIAYAASFIEWFAEEGKRVAGDTLPTPDANK-RIVVVKEPIGVCAAITPWNFPAAMIARKVGPALAAGCPIVVKPAESTPFSALAMAFLAERA----GVPKGVLSVVIGDPKAIGTEITSNPIVRKLSFTGSTAVGRLLMAQSKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFADKLAAAVSKLKVGRGTESGALGPLINEAAVKKDALAKGASLMTGGKRHALGFFEPTVLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGL--AAYLYSRDIGRVWRVAEALEYGMVGINTGSNEVAPFGGVKQSGLGREG----SHYGIDDYVVIKYLCVA...... 483
11 -78.6003jz4_A mol:protein length:481 Succinate-semialdehyde dehydrogenase [NADP+]  ali model follow..  18  33.ANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNWFNLMMEHQDDLARLMTLEQGKGEISYAASFIEWFAEEGKRIYGDTIPGHQADK-RLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAELAIRA----GVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAMSKLHIGDGLDNGVIGPLIDEKAVAKDALEKGARVVCGGKAHEGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGL--AAYFYARDLSRVFRVGEALEYGIVGINTGSNEVAPFGGIKASGLGREG----SKYGIEDYLEIKYMCIG...... 480
12 -78.4003rh9_A mol:protein length:506 Succinate-semialdehyde dehydrogenase (NAD(P)(+))  ali model follow..  17  35.ATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKGEVDYAAGFFDYCAKHISALDSHTIPEKPKDC-TWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKL----DLPDGMVNLVMGKASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIIGPLINKQGFDKDALDKGASLVAGKQPAEGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGL--ASYVFTADAERAQRVAAGLRFGHVGWNTGPTPEAPFGGMKASGIGREG----GLEGLFEFVEAQTVPRGFAENL. 488
13 -78.2003prl_A mol:protein length:505 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  20  35.ASGVALGSIPALSQEEVNDAIQGAKDAQKIWKIRPIHERVDLLYAWADLLEERKEIIGELIMHEVAKGEVSRTADIIRHTADEALRLNGETLKGDQSSKKIALVEREPLGVVLAISPFNYPVNLAAAKIAPALVTGNTVVFKPATQGSLSGIKMVEALADA----GAPEGIIQVVTGRGSVIGDHLVEHPGIDMITFTGGTTTGERISEKAIPVVLELGGKDPAIVLDDADLKLTASQIVSGAFSYSGQRCTAIKRVFVQDSVADQLVANIKELVEQLTVGSPEDDADITPVIDEKSAAFDALENGATLLSGNKR-QGNLLSPTLLDDVTPAMRVAWEEPFGPVLPIIRVKDANEAISLSNQSDYGL--QASIFTKDTDRAINIGKHLEVGTVHINAKTEDHFPFLGVKKSGLGVQG----IKPSLLSMTRERVTVLNLAEN.. 486
14 -78.2003k2w_A mol:protein length:497 Betaine-aldehyde dehydrogenase  ali model follow..  17  36.STGKVIGEIPAGCKADAENALEVAQAAQKAWAKLTARTRQNMLRTFANKIRENKHILAPMLVAEQGKMEVDVTATFIDYGCDNALTIEGDILPSDNQDE-KIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNTMVLKPTQETPLATTELGRIAKEA----GLPDGVLNVINGTGSVVGQTLCESPITKMITMTGSTVAGKQIYKTSTPVMLELGGKAPMVVMDDADLDKAAEDALWGRFANCGQVCTCVERLYVHASVYDEFMAKFLPLVKGLKVGDPMDADSMGPKCNQREIDNEAIKQGATVATGGKTATVEWYEPTVLVDVKQDNIVVHEETFGPILPIVKVSSMEQAIEFCNDSIYGL--SAYVHTQSFANINQAISDLEVGEVYINRGEQHQGFHNGWKQSGFGGED----GKFGLEQYLEKKTVYINEA.... 489
15 -78.1002hg2_A mol:protein length:479 Aldehyde dehydrogenase A  ali model follow..  17  30.ATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIVEEGGKVEVAFTADYIDYMAEWARRYEGEIIQSDRPGE-NILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEI----GLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATATKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNERNDIAMGPLINAAALERRAVEEGARVAFGGKAVEGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGL--TSSIYTQNLNVAMKAIKGLKFGETYINREEAMQGFHAGWRKSGIGGAD----GKHGLHEYLQTQVVYLQS..... 479
16 -77.9005vbf_A mol:protein length:478 NAD-dependent succinate-semialdehyde dehydrogenase  ali model follow..  19  30.GTTRVLGELPHATAHDIDAAVQAAHRAFVTWRHESPLVRSDLLRRAAALARERAETIGRHITMDQGKAEVVSAAEQLEWHAEEGRRTYGRVVPARSPDV-MQTVLREPIGVCAAFSPWNFPFSQAMHKIAAALASGCTLVLKGPEESPSAIVALAQLFHDA----GLPPGCLNIVWGVPGDVSKQLIEAPQVRKISFTGSVPVGKQLAALAKRMTMELGGHAPVLVCADADVERAAAMLAAYKFRNAGQVCVSPTRFFVQRAAFDRFVCAYLDAVGTIRVGYGLDAGVMGPLAHARRVDEDATAKGAQIATGGMRLPGPYFAPTVVLGPTRDTRLMNDEPFGPIVGIVPFDDLDDALAEANRLPFGL--ASYAFTTSARNAHRISRALEAGMVNINHFGPAEIPFGGVKDSGFGSEG----GMEAFDGYLVTKFVTQM...... 477
17 -77.8003vz0_A mol:protein length:459 Putative NAD-dependent aldehyde dehydrogenase  ali model follow..  17  13.TTETVERSFDLHTPAQMKDITDRAEHVWKTWKLRSIAQRKEIVSRAADLLRRDRQHHASLIATEMGKEEIDVTADILSFYANGAEEFLAPTPL--KVKTGQAKIINQPLGIIYCIEPWNFPYYQLARVAGPNLMAGNVVIAKHAPNVPQCALAFEKLFHDA----GAPVGAYANIFLDN-DQSAELIKDERIRGVALTGSERAGQAVAAQAKKDTMELGGSDAFIVLDDADLDLAVKWAVWGRFANNGQVCTAAKRMIVHEKVYDAFLDGLKTAITRFRIGNPLDRDTHGPMSSLRAMELEAVKGGATLVAGGKRMDRKFMEPTILTDVSKDNPVFYQEIFGPVAVVHKVASEQAAIDLANDSPYGLG--GAVFSRDIARAEKVAEQVETGMVFINTAAAPELPFGGIKNSGFGREL----SFLGIEEFINRKLVRI....... 458
18 -77.8001euh_A mol:protein length:475 NADP DEPENDENT NON PHOSPHORYLATING GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  18  26.ASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILSKEVAKSEVVRTAEIINYAAEEGLRMEGEVLEGAASKKKIAVVRREPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEA----GLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGSTGIGERIGKMARPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYDANDKGATALTEIKR-EGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGL--QASIFTNDFPRAFGIAEQLEVGTVHINNKTTDNFPFLGAKKSGAGIQG----VKYSIEAMTTVKSVVFD...... 473
19 -77.8003r64_A mol:protein length:508 NAD dependent benzaldehyde dehydrogenase  ali model follow..  20  36.YDDSVIAESKQASIADVDAAYEAAKKAQAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGSLEITLAGNITKESASFPGRVHGRISPSNTPGK-ENRVYRVAKGVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTG---GVIPARIFEEAGVPAGVISTVAGAGSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDPSAEGTVGPVINDSQLSGLAKKEGATVQVEGPI-EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGL--SAAVWSKDIDRAAQFALQIDSGMVHINDLTVPHVMFGGSKNSGLGRFN----GDWAIEEFTTDRWIGIKRSAE.. 488
20 -77.2003ek1_A mol:protein length:504 Aldehyde dehydrogenase  ali model follow..  16  50.ADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMTSEQGKGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQ-RLTVIRQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKA----GIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSTEVGRLLMAQCKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEPGVIGPMIEEKAITKDAVSKGAKLITGGKELGGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGL--AAYFYTENFSRAIRVSEALEYGMVGHNTGSNEVAPFGGVKQSGLGREG----SKYGIEEYLETKYICSAYK.... 497
21 -77.1004kna_A mol:protein length:495 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  21  26.GTNERVWEGASASADDVERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKTEVASMAAKVDISITAYHERTGEKRA--PMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVVFKPSELAPGVARATVEIWRDA----GLPAGVLNLVQGEK-DTGVALANHRQIDGLFFTGSSDTGTLLHKQFIVLALEMGGNNPLVVAEVEDIDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFDRFVARLADVASKITASVFDPQPFMGAVISARAASRRLVGLGASPIIEMKQRDPAGFVNAAILDVTNVRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGL--SAGLLADDEQAWHTFRRAIRAGIVNWNRPTNGAAPFGGAGRSGNHRPS----AYYAADYCAYPMASVESAQLQM. 479
22 -77.0004dng_A mol:protein length:485 Uncharacterized aldehyde dehydrogenase AldY  ali model follow..  17  30.YDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGGIELEQTIAILDEAMTYTGELGGVKEVPSDIEGKTNKIYRLPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGGT---IIAKAFEHAGLPAGVLNVMLTDVKEIGDGMLTNPIPRLISFTGSTAVGRHIGEIAKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQGQICMIINRIIVHQDVYDEFVEKFTARVKQLPYGDQTDPKTVGPLINERQIEKQAKTDGIELAVEGKR-VGNVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGL--SSAVFTSDLEKGEKFALQIDSGMTHVNDQSVPNIAFGGNKASGVGRFG----NPWVVEEFTVTKWISIQKQYR.. 481
23 -76.9005x5t_A mol:protein length:505 Alpha-ketoglutaric semialdehyde dehydrogenase  ali model follow..  16  50.ATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAATMRKAAALVRERADAIAQLMTQEQGKVEVLSAADIIEWFADEGRRVYGRIVPPRNLGA-QQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLRAFVDA----GVPAGVIGLVYGDPAEISSYLIPHPVIRKVTFTGSTPVGKQLASLAKRATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVKHAEGLKVGNGLEEGTLGALANPRRLTANARKVGASIETGGERIGGNFFAPTVIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGL--AGYAFTRSFANVHLLTQRLEVGMLWINQPPWPEMPFGGVKDSGYGSEG----GPEALEPYLVTKSVTVM...... 497
24 -76.9004zz7_A mol:protein length:501 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  18  29.ATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQHADEICRLIGEEHGKGELQRGIENVEYACGAPELLKGEHSRNVGPGI-DSWSEFQPMGVVAGITPFNFPVMVPLWMFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEA----GLPDGVMNVVNGDK-EAVDALLHDDRVKAVSFVGSTPIAEYIYRTAKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSGNFGPVITRQHQEKSAEQQGATIVVDGRQPKVPFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAMDLIDAHEYGN--GTCIFTRDGEAARYFSDNIQVGMVGINIPPVAYHSFGGWKRSLFG--DLHAYGPDAVRFYTKRKTVTQR...... 483
25 -76.7003iwj_A mol:protein length:503 Putative aminoaldehyde dehydrogenase  ali model follow..  20  31.ATQNIIGDIPAATKEDVDVAVAAAKTALTRWATASGAVRARYLRAIAAKVTEKKPELAKLESIDCGKPDIDDVAGCFEYYADLAEKLDARQKAPVSMDTFKSHVLREPIGVVGLITPWNYPMLMATWKVAPALAAGCAAILKPSELASLTCLELGEICKEV----GLPPGVLNILTGLGPEAGAPLATHPDVDKVAFTGSSATGSKIMTAAKPVSLELGGKSPLVVFEDVDLDKAAEWAIFGCFWTNGQICSATSRLILHESIATEFLNRIVKWIKNIKISDPLEEGCLGPVVSEGQYEKNAKSEGATILTGGSRPKGFFIEPTIITDVTTNMQIWREEVFGPVLCVKTFSTEEEAIDLANDTVYGL--GAAVISNDLERCERVTKAFKAGIVWVNCPCFTQAPWGGVKRSGFGREL----GEWGLDNYLSVKQVTQYISEE.. 492
26 -76.6004v37_A mol:protein length:497 BETAINE ALDEHYDE DEHYDROGENASE, CHLOROPLASTIC  ali model follow..  20  31.STEEIIGDIPAATAEDVEVAVVAARRAFRRWSATSGAHRATYLRAIAAKITEKKDHFVKLETIDSGKPDIDDVASCFEYFAGQAEALDGKQKAPVTMERFKSHVLRQPLGVVGLISPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLEFGEVCNEV----GLPPGVLNILTGLGPDAGAPLVSHPDVDKIAFTGSSATGSKVMASAKPVTLELGGKSPIVVFEDVDIDKVVEWTIFGCFWTNGQIASATSRLLVHESIAAEFVDKLVKWTKNIKISDPFEEGCLGPVISKGQYDKTAKSEGATILYGGSRPKGYYIEPTIVTDISTSMQIWKEEVFGPVLCVKTFSSEDEAIALANDTEYGL--AAAVFSNDLERCERITKALEVGAVWVNCSQPVQAPWGGIKRSGFGREL----GEWGIQNYLNIKQVTQDISDE.. 489
27 -76.6005kf0_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  15  29.FSGKVATRVALADAQAIDAAIGAAVDAVKPMRELPAYRRQAVLDHCVARFRERFDELAEALCIEAGKGEVTRLIDTFRVASEEAVRIDGEVLNLARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIAEVLAET----NLPKGAFSVLPAHR-DGADLFTTDERFRLLSFTGSPAVGWALKEKAKKVVLELGGNAAAIVDADQQLDYVVDRLAFGAYYQSGQSCIGVQRILVHASLYDTLRDKLVAKTRSLKMGDPKDPSTVGPMISESESRRAAVAAGAKIIAGGKV-DGAMFEATLLEDVGREQDLYRKEAFGPVAILEKFDRFDDALARVNDSDFGL--QAGVFTDSLTHAQRAWDELEVGGVVINDVRVDNMPYGGVKDSGLGREG----IRYAIEDMTEPRLMVVR...... 477
28 -76.6005j6b_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  16  29.YTGKVATRVALADASAIDAAIAAAVGAQKPLRALPAFRRQAILEHCVARFRERFDELAQALCIEAGKGEVTRLIDTFRVAAEESVRIEGGLVNLERAQGYSGYYKRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPIGALIIGEVLAET----DLPKGAFSILPAHR-DGADLFTTDERFKLLSFTGSPTVGWELKKKAKKVVLELGGNAAAIVDADQRLDYVVERLAFGAYYQSGQSCIGVQRIIAHADVYDALREKLIAKTRSLKMGDPKDPATVGPMISESEARRAAVAAGAKIVAGGKV-DGAMFEATLLEGVGRDQDLYRKEAFGPVALLERFSDFDDALARVNDSDFGL--QAGVFTDSLSHAQRAWDELEVGGVVINDVRVDNMPYGGVKDSGLGREG----IRYAIEDMTELRLMVVR...... 477
29 -76.4003efv_A mol:protein length:462 Putative succinate-semialdehyde dehydrogenase  ali model follow..  19  15.ATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDIGQALRAHAEEMAQCITREMGKAEVTKSAALCDWYAEHGPAMLNPEPT--LVENQQAVIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEA----GTPAGVYGWVNANN-EGVSQMINDPRIAAVTVTGSVRAGAAIGAQAKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDPLVEENLGPMARFDLRDEASVAEGARLLLGGEKIAGEYYAATVLADVTPDMTAFRQELFGPVAAITVAKDAAHALALANDSEFGLS--ATIFTADDTLAAEMAARLECGGVFINGYSDARVAFGGVKKSGFGREL----SHFGLHEFCNVQTVWKN...... 460
30 -76.4005izd_A mol:protein length:508 D-glyceraldehyde dehydrogenase (NADP(+))  ali model follow..  19  26.VTGQVIGRFEAATRDDVDRAIDAAEDAFWAWNDLGSVERSKIIYRAKELIEKNRAELENIIMEENGKEEVDGVIDQIQYYAEWARKLNGEVVEGTSSHR-KIFQYKVPYGIVVALTPWNFPAGMVARKLAPALLTGNTVVLKPSSDTPGSAEWIVRKFVEA----GVPKGVLNFITGRGSEIGDYIVEHKKVNLITMTGSTATGQRIMQKAAKLILELGGKAPFMVWKDADMDNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFMSRFVELSRKLALGDPKNADM-GPLINKGALQAEAKESGAKILFGGSQPSLSFFLPTIIGNADQKSKIFQEEIFAPVIGARKISSVEEMYDLANDSKYGL--ASYLFTKDPNIIFEASERIRFGELYVNMPEASQGYHTGFRMTGQAGEG----SKYGISEYLKLKNIYVDYSGK.. 480
31 -76.3001wnb_A mol:protein length:495 Putative betaine aldehyde dehydrogenase  ali model follow..  13  40.ATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFAELESRNCGKPEIPAIVDVFRFFAGAARCLNGLAAGEYLEGH-TSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDIF-----PAGVVNILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTLGPLSSLAHLEREAKATGHIKVITGGE-NGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGL--ASSVWTKDVGRAHRVSARLQYGCTWVNTHFMSEMPHGGQKLSGYGKDM----SLYGLEDYTVVRHVMVK...... 488
32 -76.2003ros_A mol:protein length:484 NAD-dependent aldehyde dehydrogenase  ali model follow..  16  12.YTNEAFASYDNPTSKQIDEAINLAHALYKKWRHEEPASRAEILHDIANALKEHEDELAKMMTLEMGKEEVELCVSICNYYADHGPEMLKPTKL--NSDLGNAYYLKQSTGVIMACEPWNFPLYQVIRVFAPNFIVGNPILLKHAHNVPGSAALTAKIIKRA----GAPEGSLINLYPSY-DQLADIIADPRIQGVALTGSERGGSAVAEAAKKSTMELGGNDAFIVLDDADPQVLRNVLNDARTYNDGQVCTSSKRIIVEKSRYDEVLHELKNVFSNLKAGDPLEADTLPPMNSEKAKEKEAIDAGAKVFYQYPEIDGAFFRPTILTDIAKDNPVFDKEVFGPIAEVFVVEDDNAAIQLANDSSYGLG--SSVIGSDIDRAKKVSAQIETGMTVINGRTSGELPFGGIKKSGYGREL----SGLGLMAFVNEHLVIDVTKNN.. 461
33 -76.0005mz5_A mol:protein length:515 ALDH21)  ali model follow..  15  56.YTNDVAAKVPQATHKDIDDAIDAAVAAAPAMAAMGAYERKAVLEKVVAELKNRFEEIAQTLTMESGKGEVTRTIDTFQVAAEESVRIYGEHIPLARNKGLQGIVKKFPIGPVSMVSPWNFPLNLVAHKVAPAIAVGCPFVLKPASRTPLSALILGEILHKI---EELPLGAFSILPVSR-EDADMFTVDERFKLLTFTGSGPIGWDMKARAKKVVMELGGNAPCIVDDYVDLDYTIQRLINGGFYQGGQSCIHMQRLYVHERLYDEVKEGFVAAVKKLKMGNPFEEDTLGPMISESAAKGEAVAKGGKLLTGGNR-KGAFIEPTVIEDVPIEANARKEEIFGPVVLLYKYSDFKEAVKECNNTHYGL--QSGIFTKDLNKAFYAFEHMEVGGVILNDSRVDSQPYGGLKDSGIQREG----VKYAMDDMLETKVLVMRNVGTL. 509
34 -76.0005jry_A mol:protein length:485 NAD-dependent aldehyde dehydrogenase  ali model follow..  15  29.YSGKVATRVALADAKAIDAAIGAAVDATKPMRELPAYKRQAVLDHCVARFRERFDELAEALCIEAGKGEVTRLIDTFRVASEEAVRIDGEVLNLARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIGEVLAET----DLPKGAFSVLPAHR-DGADLFTTDDRFRLLSFTGSPAVGWALKEKAKKVVLELGGNAAAIVDADQRLDYVVDRLAFGAFYQSGQSCIGVQRILAHADIYDALRDKLIAKTRSLKMGDPKDPSTVGPMISESESRRAAVAAGAKIVAGGKV-DGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALARVNDSDFGL--QAGVFTDSLAHTQQAWDELEVGGVVINDVPVDNMPYGGVKDSGLGREG----IRYAIEDMTEPRLLVVR...... 477
35 -76.0006fk3_A mol:protein length:536 Aldehyde dehydrogenase  ali model follow..  19  39....DVVARFPEADKDLVRKAALKAREAFAEWSRTPAPIRGQVLFNLVKILEREKPTLTRLMVREVGKGDVQEAIDTALFFASEGRRLYGQTVPSEMRDK-ELFTFRRPLGVVGIITAGNFPIAVPSWKLIPAVLTGNTVVWKPSEDAPTLSFVFAKLFEEA----GLPPGVLNVVFGGGKQWMVELMDEGLFQKFAFTGSTQVGRWIGEVAIRPTLELGGKNPLVVMRDADLDLAVEGAWWSAFATGGQRCTSAGNILVDAPIYEEFKRRFLERVEATLVGNPHPEVTYGPFINERFFARVGEAEGARLLFGRGRITRELYGWPTVWEVRPGTRLFTEEVFGPTINLVKVDGIEEAIAVANSTPYGL--SSAIYTNHRHWAYLFKVGIRAGMTSINNATVGALPFGGVKASGNG---GRESGIWVLEEYTYWHAVNEEYSGRLQ 507
36 -75.9003vz2_A mol:protein length:470 Succinate-semialdehyde dehydrogenase  ali model follow..  17  19.TTGEICQRFKALTPAEIDAKLAKAQEAFQAYRRTSFSQRRQWLENAAAILERDTSKFAEIMTTEMGKAEAEKSALVCRYYAEHGEQFLANEYT--ETQATESYVCYQPLGILLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAA----GFPEGVFQTLLI-GASQVEQVIKDPRVKAATLTGSEPAGASLASLAKPTLLELGGSDPFVVFPSADLDEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKIGDPMAPETIGPLATEGILQDQAVAAGAKILLGGRPLDRAFYPPTILTEIPPGAKILQEELFAPVAMVFTVKDLDQAIALANDIPFGLG--ASAWTNDPAEQQRFIQELDAGAVFINGMADPRLPFGGTKRSGYGREL----GLAGIRTFVNAKTVWLK...... 464
37 -75.7004dal_A mol:protein length:498 Putative aldehyde dehydrogenase  ali model follow..  15  42.RTGAGIIDLAEASHAQIDAAVDAAERAFVGWSQTTPAERSNALLKIADAIEKEADEFAALEALNCGKPELPAIIDCWRFFAGAVRNLHAPAAGEYLPGH-TSMIRRDPIGIVGSIAPWNYPLMMMAWKLAPAIGGGNTVVFKPSEQTPLTALKLARLIADIL-----PEGVVNVITGRGETVGNALINHPKVGMVSITGDIATGKKVLAAAKRTHLELGGKAPVIVYGDADLEAVVNGIRTFGYYNAGQDCTAACRIYAEAGIYEKLVADLTSAVSTIRYNLDDDTENIGPLISRRQRDRRAADQKHIEITTGGRTEGFFFQPTVVAGATQEDEIVRREVFGPVVSVTRFTGKDDAVAWANDSDYGL--ASSVWTKDISKAMRAASRLQYGCTWINTHFMNEMPHGGIKQSGYGKDM----SVYALEDYTAVRHIMINHG.... 492
38 -75.6004lih_A mol:protein length:504 Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase  ali model follow..  19  45.IDGRVLAKVADCGEADVNAAVAAARRAFDAWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPDVPGAAYCVEWFAEAIDKVGGEVAPA--DHHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEA----GIPAGVFNVVPGAG-EPGKLLALHRDVDCIAFTGSTAVGKLIMQYAKRAWLELGGKSPNIVLPDCDLDRAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVMGAIVDGIQLERAGRGEGRLVTGGARAETGGFYVEPTVFEVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTEYGL--AAAVWTSNLTTAHDVSRRLRAGTVWVNCYDEGNFPFGGYKQSGNGRDK----SLHALEKYTELKSTLIR...... 496
39 -75.6004ogd_A mol:protein length:465 Succinate-semialdehyde dehydrogenase  ali model follow..  15  9.YTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHEERKAQLHQVANILRRDRDKYAEIMTKDMGKGEVDLCADIADYYADKADEFLMSTPL--ETDSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEA----GAEAGSITNLFISYDQVS-QVIADKRVVGVCLTGSERGGASIAEEAKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETLAPLSSAQAKADLALDHGAELVYGGEAIDHPFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLG--GTIFSSNQEHAKAVAAKIETGMSFINSGSLPELPFGGIKHSGYGREL----SELGFTSFVNEHLIYIPNKTN.. 459
40 -75.6005kj5_A mol:protein length:520 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  17  55.VNGKLISDVFEADAKQVNEAVVAAQNALKPWGKLSVQDRAALIHKIADGIQARFEEFVAAEVADTGRPDIPRAIANFRTFADLAKTSHTDLFEMSTGSGALNYTVRKPLGVIGVISPWDLPLLLFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMHDA----GVPPGVFNLIHGFGKDAGEFLTQHPGISALTFTGESKTGSTIMKAVKEVSFELGGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVSGLKVEAERLVVGYPDQDGVMGPLISHGHRDKLAVDEGATVVTGGGVPKFNYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGL--ACAIWTTNLSRAHRVSRQIHVGLVWVNTWYLLRTPFGGVKLSGLGREG----GRFSMDFYSDIANICIK...... 513
41 -75.5005u0l_A mol:protein length:497 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  20  28.VTGETVWDGNAASLEDVDAAVREARKAFLAWRRKSLAERQAVIEAFGELLEANKEELAHQIGLETGKTEVAAMMGKIPISVKAYNERTGHTES--DVAGGHAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVRLWEKA----GLPDGVINLVQG-GSDTGKCLARHSLIDGLFFTGSSTVGHLLHEQFKILALEMGGNNPLIVQNVSDLDGAVHHALQSAFLSAGQRCTCARRLLVPKGKKDEFLARLVEVAARITVAEFDPQPFMGSVISAEAANQAMLEKGATSLLEMKQLDTGLLSPGIVDAT--GIELEDQEFFGPLLTVYRYKGFDEALELANNTRYGL--SAGILSDDRKLYNRLVEEVRAGIVNWNRPASSAAPFGGVGASGNHRPS----AYYAAD-YCAWPMASLEAG.... 476
42 -75.3001t90_A mol:protein length:486 Probable methylmalonate-semialdehyde dehydrogenase  ali model follow..  20  29.ATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKGEVGRGIENVEFAAGAPSLMMGDSLASIATDV-EAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKA----GLPKGVFNVVYGAH-DVVNGILEHPEIKAISFVGSKPVGEYVYKKGKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVLGPVIREDNKKRKGLEEGARLVCDGRENDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFAN--GACLFTSNSNAIRYFRENIDAGMLGINLGPMAFFPFSGWKSSFFG--TLHANGKDSVDFYTRKKVVTAR...... 479
43 -75.3003iwk_A mol:protein length:503 Aminoaldehyde dehydrogenase  ali model follow..  19  31.STENIIGDIPAATKEDVDLAVDAAKRAISRWSAASGSLRARYLRAIAAKIKEKKDELGKLESIDCGKADLDDVVACFEYYAGLAEELDSKQKAPISMDTFKSYILKEPIGVVALITPWNYPFLMATWKIAPALAAGCAAILKPSELASVTCLELGEICKEV----GLPRGVLNIVTGLGHEAGASLASHPDVDKISFTGSSATGSKIMTTAKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHESIAVEFVDKLVKWAENIKISDPLEEGCLGPIVSEAQYKKSAKSEGATILTGGRRPKGYFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGL--GSAVMSNDLERCERLSKALQAGIVWINCAQPIQAPWGGIKRSGFGREL----GEWGLENYLSVKQVTRYTSDE.. 492
44 -75.0004i8p_A mol:protein length:520 Aminoaldehyde dehydrogenase 1  ali model follow..  20  42.TTEAHIGEIPAGTAEDVDAAVAAARAALKRWARAPGAVRAKYLRAIAAKVIERKPELAKLEALDCGKPDMDDVAGCFEYFADQAEALDKRQNSPVSMETFKCHLRREPIGVVGLITPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLELADICKEV----GLPSGVLNIVTGLGPDAGAPLSAHPDVDKVAFTGSFETGKKIMASAKPVTLELGGKSPIVVFDDVDIDKAVEWTLFGCFWTNGQICSATSRLLIHTKIAKKFNERMVAWAKNIKVSDPLEEGCLGPVVSEGQYEKNAKSQGATILTGGVRPKGFFIEPTIITDITTSMEIWREEVFGPVLCVKEFSTEDEAIELANDTQYGL--AGAVISGDRERCQRLSEEIDAGCIWVNCPCFCQAPWGGNKRSGFGREL----GEGGIDNYLSVKQVTEYISDE.. 503
45 -74.9002d4e_A mol:protein length:515 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase  ali model follow..  19  50.ATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMECLDAGQAQVARAAENFAFYAEYAEHAMEDRTFPVDRDW-LYYTVRVPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEA----DLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNAKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETVGPLIHPEHLQRAGKREGARLLVGGERAKTSYLLPTVFVGEN-HMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGL--AAYVFTRDLERAHRLALELEAGMVYLNSHNVLPTPFGGVKGSGDRREG----GTYALDFYTDLKTIALPLR.... 506
46 -74.8004x0t_A mol:protein length:513 Alpha-aminoadipic semialdehyde dehydrogenase  ali model follow..  16  46.ANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKGEVQEYVDICDYAVGLSRMIGGPILPSERSGH-ALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCG-GADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVYGPLHTKQAVSMEAKKEGGTVVYGGKVMDRPYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGL--SSSIFTKDLGRIFRWPKGSDCGIVNVNIPTSGGGAFGGEKHTGGGRES----GSDAWKQYMRRSTCTINYSKDL. 504
47 -74.6003rjl_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  19  63....EVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFRAVAKVRRKKHEFSALLVKEAGKADTAEAIDFMEYYARQMIELAKGKPVNSREGE-RNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVLEES----GLPKGVVNFVPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAKQVIAEMGGKDTVVVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKRVIEITESKKVGEPDSADVMGPVIDQASFNKEIGKEEGRLVSGGKGDKGYFIEPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGL--TGAVITKNRDHINRAKQEFHVGNLYFNRNCTGAIPFGGFKMSGTDSKAG---GPDYLALHMQAKTISEMFAEN.. 519
48 -74.6004e4g_A mol:protein length:521 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  19  44.ATGEVQGTVALASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGI-DMYSIRQPVGIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEA----GLPAGILNVVNGDK-GAVDAILTHPDIAAVSFVGSTPIARYVYGTAKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISAVPVGEETANRLIDKLVPMVESLRIGPYTDEKAMGPVVTKEAEQRSGIEQGAKLVVDGRDFKLQFIGGCLFDDVTPDMDIYKTEIFGPVLSVVRARNYEEALSLPMKHEYGN--GVAIYTRDGDAARDFASRINIGMVGVNVPPLAYHSFGGWKSSSFG----NQHGTDSIKFWTRTKTITSR...... 498
49 -74.6005tjr_A mol:protein length:531 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  19  53.STGEAVRKVPLADRETMQQAIDAAKAAFPAWRNTPPAKRAQVLFRFKQLLEANEERIVKLISEEHGKGELKRGIENVEYATAAPEILKGEYSRNVGPNI-DAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAIACGNTFILKPSERDPSSTLLIAELFHEA----GLPKGVLNVVHGDK-GAVDALIEAPEVKALSFVGSTPIAEYIYSEGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCMAISAVCVGDQIADALVQKLVPQIKGLKIGAGTSCGLMGPLVTGAARDKTGVAQGAELVVDGRGYKVAFLGGTLFDRVTPEMTIYKEEIFGPVLCIVRVNSLEEAMQLINDHEYGN--GTCIFTRDGEAARLFCDEIEVGMVGVNVPPVAYHSFGGWKRSLFG----HAYGPDGVRFYTKRKAITQR...... 507
50 -74.5004go3_A mol:protein length:495 Putative gamma-hydroxymuconic semialdehyde dehydrogenase  ali model follow..  18  26.HDGSLITRIAAAEAADVDLAVAAAKRAFPAWSALGAAERGRLLLKLADRIEECSEELAQLESLNTGHPDVPRTAACFRYFGGMADKIEGSVIPV--DAGFLNYVQRKPIGVVAQIVPWNFPLMFTSWKMGPALAAGNTIVIKPSEITPLSTLRIVELMTEV----GFPKGVVNVVPGYGHTAGQALAEHLDVGKIAFTGSTATGRRIVEASKRIQLELGGKGANIVFEDANIEAAVNGAAWAIFHNQGQACIAGSRLILHKDIADQFLERFIALAKSIRLGDPMDPETMGPLTSALRRDRIAIEQGGKVLAGGKAPDDKFYVEPTVVEAKPQDRVCQEEVFGPFVTVVRFSSDEEALAIANNTEYGL--GSGLWTQNLARAHKMANAIHAGMCWINCYKRPGSPFGGVGQSGYGREM----GFEAIHDYTEARSVWVNVDAK.. 480
51 -74.4001ky8_A mol:protein length:501 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  18  40.IDLATIAKVISPSREEVERTLDVLFKRGRSARDMPGTERLAVLRKAADIIERNLDVFAEVLVMNAGKGEVKAAVDRLRLAELDLKKIGGDYIPGYDTLETEGLVRREPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDA----GFPPDAIALLNLPG-KEAEKIVADDRVAAVSFTGSTEVGERVVKVGKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDPTVVGPLISPSAVDEDAVEKGGRVLAGGRRLGPTYVQPTLVADRVKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGL--DAAVFGRDVVKIRRAVRLLEVGAIYINDMGIGYYPFGGRKKSGVFREG----IGYAVEAVTAYKTIVFNYKGK.. 495
52 -74.4003ju8_A mol:protein length:490 Succinylglutamic semialdehyde dehydrogenase  ali model follow..  19  28.VGQGVVWSGRGADATQVDAAVCAAREAFPAWARRPLEQRIELLERFAATLKSRADELARVIGEETGKTEVTSMVNKVAISVQAFRERTGEKSG--PLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAELTLKAWIQA----GLPAGVLNLVQG-GRETGVALAAHRGLDGLFFTGSSRTGNLLHSQFKILALEMGGNNPLVVEEVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWDALLARLVAVSATLRVGREQPAPFMGAVISLSAAEHHLIGKGAQPLLAMTQPDGAALLTPGILDVSAVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGL--AAGLLSDSRERFEQFLVESRAGIVNWNKQAASSAPFGGIGASGNHRPS----AYYAADYCAYPVASLESPSVSL. 481
53 -74.3004ywe_A mol:protein length:487 Putative aldehyde dehydrogenase  ali model follow..  18  29.SDGQPFATIARGTAPDIERAVAAARDAFAPWGAASAAERGRVLMRLSARVTDSIEELAAIEARDTGKADAAALARYFEFYAGAADKLHGETLPY--QAGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACLSVLRVAELAAEA----GLPAGALNIVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAVPVTLELGGKSPQIVFADADLDAALPVLVSAIVQNGGQTCSAGSRVLIERAVYEPLVERLATAFNGLRVGPSRADLDCGPLINAKQQQRDAQHDGIPMAAHGQVVSGFYQAPALLRDVPPSHRLAQEEVFGPVLAAMRFVDEDEAVALANGTPYGL--VAGIWTRDGARQMRLARRLRAGQVFINNYGAVELPFGGVGHSGHGREK----GFEALYGFTALKTIAIRHG.... 481
54 -74.1006c43_A mol:protein length:477 Gamma-aminobutyraldehyde dehydrogenase  ali model follow..  14  28.ATGEVILEIAEASPAQVDAAVQAADNAFAEWGQTTPKARAECLLKLADSIEQNALEFARLESQNCGKPEIPAIVDVFRFFAGAARCLSGLAAGEYLEGH-TSMIRRDPIGVVASIAPWNYPLMMAAWKLAPALAAGNCVVIKPSEITPLTALKLAVLAK-----DIFPPGVLNVLFGRGQTVGDVLTGHEKVRMVSLTGSIATGEHILRHTKRTHMELGGKAPVIVFDDADLDAVAQGVRTFGFYNAGQDCTAACRIYAQRGIYDALVEKLGNAVSSLKMGAPEDESTLGPLSSLAHLKRVTALSHIRVITGGSQTEGYYFAPTLLADAKQEDAIVQREVFGPVVSITVFDDEDQVLRWANDSRYGL--ASSVWTQDVGRAHRLSARLQYGCTWINTHFMSEMPHGGQKQSGYGKDM----SLYGLEDYTLVRHIMVK...... 476
55 -73.9004i9b_A mol:protein length:517 Putative betaine aldehyde dehyrogenase  ali model follow..  20  41.ATEEIIGDIPAATAEDVDIAVEAARKAIARWGSTTGAQRAKYLRAIAAKVLEKKSVLATLESLDSGKADMDDVAGCFEYYAGLAEALDSRRMTPVNSDSYKSYVLREPLGVVGLITPWNYPLLMAIWKVAPALAAGCAAILKPSELASITCLELGEICREI----GLPSGALNILTGLGPEAGGPLASHPHVDKISFTGSGPTGSKIMTAAKPVSLELGGKSPIVVFDDIDLDIAAEWTLFGIFANTGQVCSATSRLIVQENIASAFMDRLLKWTKNIKISDPLEEDCLGPVVSAGQYEKNAKSEGATILCGGERPKGYYVQPTIITDVNTSMEIWKEEVFGPVLCVKTFKTEEQAIELANDTKYGL--GAAVMSKDVKRCERFTKAFQTGIIWINCSQPNELPWGGKKRSGFGRDL----GKWGLENFLNIKQVTEYTSAE.. 500
56 -73.8003ty7_A mol:protein length:478 Putative aldehyde dehydrogenase SAV2122  ali model follow..  16  31.ATEEVIGKVAKGNKADVDKAVEAADDVYLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDNEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKV----GVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAKKVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELKEQFSQVRVGNPREDGTVGPIISKKQFDQKGIEEGAELFYGGPGKKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGL--AGYVIGKDKETLHKVARSIEAGTVEINEAGRKDLPFGGYKQSGLGREW----GDYGIEEFLEVKSIAGY...... 476
57 -73.7004u3w_A mol:protein length:505 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  16  39.VDGRKLADVCEADAALVDSAVQAAHAAQKAWRDTTPAQRAAWLHKIADGIEARFDEFVAAEVADTGRPDIARGIANFRTFADLVRTASGEYFETHAADGSINYVTRKPLGVIGIISPWNLPLLLFTWKVAPALAMGNCVVAKPSEETPSSATLLAEVMHDV----GLPPGVFNLIHGHGQNAGEFLTRHPDISAITFTGESRTGSTIMKAVKEVSFELGGKNAAVVFADADFDAAVAGVLRSSFTNAGQVCLCSERVYVERPIFERFVAALKEQAQALRVGAPEDPATMGPLISRGHRDKLAVEEGATVVTGGGAPDGAFVMPTIWTGLPDSARCVREEIFGPVCHIAPFDDEAEVVKRVNDSAYGL--AASIWTTQLARGHRVAKQIETGIVWVNAWFVLRTPFGGTKLSGLGREG----GRHSLDFYSELTNVCVRIA.... 499
58 -73.7002jg7_A mol:protein length:510 ANTIQUITIN  ali model follow..  16  43.ANNEPIARVTQATLAEYEETVQKTREAWKMWADIPAPKRGEIVRQIGDALRKKIKVLGSLVSLEMGKGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGH-ALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVAVTKIVAEVLEQNNLPGAICSMTCG-GADIGTAMAKDERVDLLSFTGSTHVGKMVAMMVGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVVERIAKAYKQVRIGDPWDPSTYGPLHTKQAVDQQAKQQGGTLVCGGKVMDGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGL--SSSIFTKDLGRVFRWPKGSDCGIVNVNIPTSGGGAFGGEKHTGGGRES----GSDSWKQYMRRSTCTINYSKDL. 501
59 -73.4004pxn_A mol:protein length:525 Uncharacterized protein  ali model follow..  18  53.TNNQVIAEVVEASVHDYEEGMRACFDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNH-MMMEVWNPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVASVLEKNNLPGAIFTSFCG-GTEIGQAIALDIRIPLVSFTGSTRAGLMVQQQVGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLILHENIYQTFLDQLVEVYKQVRIGDPLEKGTLGPLHTPASKENTIKSQGGKILFGGSAIESENFVQPTIVEITPSAPVVKEELFGPVLYVMKFQTLKEAIEINNSVPQGL--SSSIFTKRPDIIFKWPHGSDCGIVNVNIPTNGGGAFGGEKATGGGREA----GSDSWKQYMRRATCTINYGSEL. 510
60 -73.2004nm9_A mol:protein length:1005 Proline dehydrogenase and Delta-1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  18  534..PSEVLGQICQAGTTEVGDAIAAAKAAFPAWRDTDPRTRAEYLLKAAQAARKRLFELSAWQVLEIGKADVTEAIDFLEYYAREMIRLGQPQRVGHAPGE-LNHYFYEPKGVAAVIAPWNFPLAISMGMASAAIVTGNCVVFKPSGITSIIGWHLVELFREA----GLPEGVFNFTPGRGSVMGDYLVDHPDISLIAFTGSMETGLRIIERAKKIISEMGGKNAIIIDDDADLDEAVPHVLYSAFGFQGQKCSACSRVIVLDAVYDKFIERLVSMAKATKVGPSEDPANMGAVADDKAMKSIGKREGHVLYESPV--EGYFVPMTIIGGIKPEHRIAQEEIFGPVLAVMRAKDFDQAIEWANSTQFAL--TGGIFSRSPEHLAKARREFRVGNLYINRNNTGALPFGGARMSGVGTKAG---GPDYLLHFMDPRVVTENTMRR.. 992
61 -73.2001bi9_A mol:protein length:499 RETINAL DEHYDROGENASE TYPE II  ali model follow..  19  42.ATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPDLQGVIKTLRYYAGWADKIHGMTIPV--DGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEA----GFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTQGPQIDKKQYNKSGVAEGAKLECGGKGLKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGL--VAAVFTNDINKALMVSSAMQAGTVWINCYNAAQSPFGGFKMSGNGREM----GEFGLREYSEVKTVTVKIPQK.. 497
62 -73.1003i44_A mol:protein length:497 Aldehyde dehydrogenase  ali model follow..  17  43.STEEACAVISLGSTRDADKAINAAKKAFQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPQTATGSSHIRNFIKAYKEFSFQEALI--EGNEQAILHYDAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSAMLFAEILDEA----ALPSGVFNLINGDGANVGSYLSAHPDLEMISFTGSTRAGKDISKNAKRVCLELGGKGANIIFADADID-ALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNIGPVVSKEQYDKSGIDEGATLVTGGTGLRGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGL--TNYIQSQDRSKCRRIAAQVRSGMVEVNGHELGGSYFGGVKFSGRAREG----GLWGIKEFLDTKAI......... 488
63 -72.9004i3t_A mol:protein length:488 Aldehyde dehydrogenase (NAD+)  ali model follow..  18  37.WNDTVVGTVPAGRAEHAREAFAIAAAY---QPKLTRYERQKILLATAEALAARKEEISDVITLELGIYEVGRAFDVFTLAGQMCIRDDGEIFSCDLGKARKIFTMREPLTAISAITPFNHPLNMVAHKVAPAIATNNCVVVKPTELTPMTALLLADILYEA----GLPPEMLSVVTGWPADIGMEMITNPHVDLVTFTGSVPVGKLIAANAKRQVLELGGNDPLIILNDLDLARAADLAVAGATKNSGQRCTAVKRILCQESVADRFVPLVLERAKRLRFGDPMDRSTLGTVIHEKAAALRAAEEGADILYHPGR-SGALLPPIVVDRVPHQSDLVLEETFGPIIPIVRVPDDDDAITLSNSTAFGL--SSGVCTNDYRRMQKYIAGLKVGTVNIWEVPIEMSPFGGIKDSGNGYKEG---VIEAMKSFTNVKTFSLP...... 486
64 -72.8004o6r_A mol:protein length:496 Aldehyde Dehydrogenase  ali model follow..  19  28.HDGSVITKIAAATAADVDLAVDAATRAFPAWSAMPAAERGRLLLRLADAIEANTEALAQLESLDTGHPDVPRTAACFRYFGGMADKLQGSVIPV--DTGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPALAAGNTVVLKPSEITPLSTLRIVELMAEV----GFPAGVVNIVPGYGHTAGQRLAEHPGVGKIAFTGSTATGRRIVEASKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQACIAGSRLVLHERIADAFLERFVALASSIRIGNPLDPNTMGPLTSKQHLDRVAREQGGRVLTGGSAPQDPYVRPTIVEAKHATDRVAQEEVFGPFVTVLRFGSDDEALAIANATEYGL--GSGLWTNDLSRAHRMAARIDAGMCWINCYKRPGSPFGGVGKSGYGREM----GFEAMHDYTEARSVWVNVDGN.. 483
65 -72.8003u4j_A mol:protein length:528 NAD-dependent aldehyde dehydrogenase  ali model follow..  21  48..AGEVVGTWPEASADDVRKAVAAARKAFDAWPRMSGAERSRLMFKVADLILARQEELALIESLEVGKGEIGFCADLWSYAAGQARALEGQTHNNIGDDR-LGLVLREPVGVVGIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREA----GIPDGVFNVVTGYGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAKRVGLELGGKGPQIVFADADLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTIGAMISEAHAEKAGITSGAELLLGGERIGGLYYAPTVFAGVTPDMSIAREEIFGPVLSTLTFKTADEAVALANATEFGL--SASVWSTNLETALQTIRRIRAGRCWINSVGTPELPIGGYKKSGLGREL----GRYGFDEYSQFKGVHVTLG.... 499
66 -72.7002w8n_A mol:protein length:487 SUCCINATE-SEMIALDEHYDE DEHYDROGENASE, MITOCHONDRIAL  ali model follow..  16  34.ASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKGEILYSAFFLEWFSEEARRVYGDIIHTPAKDR-RALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQA----GIPSGVYNVIPCSAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAKKNLRVGNGFEEGTQGPLINEKAVEKDAVSKGATVVTGGKRHQKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGL--AGYFYSQDPAQIWRVAEQLEVGMVGVNEGSSVECPFGGVKQSGLGREG----SKYGIDEYLELKYVCY....... 484
67 -72.6004h73_A mol:protein length:491 Aldehyde dehydrogenase  ali model follow..  19  32.VDGSKIAEVPRSGREDAREAIDSAFEALKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGGGEVVFTERLIQNAAELARHYQGRVLQSDSEST-ISVVFKRSKGVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTGWLIAQMVAKA----GLPKGVFNLVIGPGPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDPDEKVDLGPLINERQVALDAVSRGGRLLIGGRS-WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGL--SGAVLTNNVNRAFRIAEAVESGMFHINDVTFSHVPFGGIKASGVGREG----GEWSFHETTYDRWVTVTLRTR.. 482
68 -72.5004x2q_A mol:protein length:504 Retinal dehydrogenase 2  ali model follow..  19  41.ATGEQVCEVQEADKADIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPDLQGVIKTFRYYAGWADKIHGMTIPV--DGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEA----GFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTQGPQIDKKQYNKSGVAEGAKLECGGKGLKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGL--VAAVFTNDINKALTVSSAMQAGTVWINCYNAAQSPFGGFKMSGNGREM----GEFGLREYSEVKTVTVKIPQK.. 496
69 -72.5004q92_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  17  47.YNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKADMDDIHNVFMYFAGLADKDGGEMIDSPIPDT-ESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEV----GFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGSIETGKHIMKNATNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTMGPVISTEHRNKVAKAEGATIAVGGKRPDRDFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGL--AGAVFSKDIGKAQRVANKLKLGTVWINDPYFAQAPWGGYKQSGIGREL----GKEGLEEYLVSKHILTNTNPQ.. 504
70 -72.5001a4z_A mol:protein length:499 ALDEHYDE DEHYDROGENASE  ali model follow..  17  42.STGDVICHVAEGDKADVDRAVKAARAAFQPWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPDLDMVLKCLRYYAGWADKYHGKTIPI--DGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA----GFPPGVVNVIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTQGPQVDETQFKKSGKEEGLKLLCGGGAARGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGL--AAAVFTKDLDKANYLSQALQAGTVWVNCYDVAQSPFGGYKLSGSGREL----GEYGLQAYTEVKTVTVRVPQK.. 497
71 -72.4005fhz_A mol:protein length:529 Aldehyde dehydrogenase family 1 member A3  ali model follow..  21  66.STREQICEVEEGDKPDVDKAVEAAQVAFQRWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPDLEGCIRTLRYFAGWADKIQGKTIPT--DDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEA----GFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAAKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTQGPQIDQKQFDKSGKKEGAKLECGGSAMKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGL--TAAVFTKNLDKALKLASALESGTVWINCYNAAQAPFGGFKMSGNGREL----GEYALAEYTEVKTVTIKLGDK.. 521
72 -72.4001o9j_A mol:protein length:501 ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1  ali model follow..  19  44.ATEEKICEVEEADKEDVDKAVKAAREAFQMWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKVDLDYCIKALRYCAGWADKIQGRTIPV--DGEFFSYTRHEPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEA----GFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKMIQEAAKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPLTPGVHGPQINKAQHNKSGKKEGAKLECGGGPWKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGL--VAGVFTKDLDKAVTVSSALQAGTVWVNCYLAAQSPAGGFKMSGHGREM----GEYGIHEYTEVKTVTMKISEK.. 499
73 -72.4004mpb_A mol:protein length:520 Betaine aldehyde dehydrogenase  ali model follow..  17  50.YNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKADMDDIHNVFMYFAGLADKDGGEMIDSPIPDT-ESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEV----GFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGGIETGKHIMKNATNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTMGPVISTEHRNKVAKAEGATIAVGGKRPDRDFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGL--AGAVFSKDIGKAQRVANKLKLGTVWINDPYFAQAPWGGYKQSGIGREL----GKEGLEEYLVSKHILTNTNPQ.. 507
74 -72.3001bxs_A mol:protein length:501 ALDEHYDE DEHYDROGENASE  ali model follow..  20  44.ATEEKLCEVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLDLGGCIKTLRYCAGWADKIQGRTIPM--DGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEA----GFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEAAKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVQGPQIDKEQYEKSGKKEGAKLECGGGPWKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL--SAGIFTNDIDKAITVSSALQSGTVWVNCYSVAQCPFGGFKMSGNGREL----GEYGFHEYTEVKTVTIKISQK.. 499
75 -72.3004wb9_A mol:protein length:501 Retinal dehydrogenase 1  ali model follow..  21  44.ATEEELCQVEEGDKEDVDKAVKAARQAFQPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLDLAGCIKTLRYCAGWADKIQGRTIPI--DGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEA----GFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVQGPQIDKEQYDKSGKKEGAKLECGGGPWKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL--SAGVFTKDIDKAITISSALQAGTVWVNCYGVAQCPFGGFKMSGNGREL----GEYGFHEYTEVKTVTVKISQK.. 499

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;