current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -107.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model  100  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
2 -98.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  98  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
3 -96.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
4 -94.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  98  17..ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
5 -93.2004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  99  20..ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
6 -87.2002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
7 -84.2004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  98  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
8 -66.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  40  26.SFWTKVQYQRLKELNASGEQLELSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPERHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -51.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  2..............AMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGL-WEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVCQRLWEDLGLGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQ-----EIVRNAPKLIDFLGDVSRA. 256
10 -50.3002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  4..............................YQDPMAKNIQAIRGMNDYLPGETAI-WQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELITARWWRALGIHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQ-----ALLNDAPALGDYLDEESRE. 242
11 -49.3003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR-CRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPVEAQLAVLGLEPTVVDAITT-TLSLKSIDEIAQRVGEEHEAV 259
12 -48.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  2.................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVACTAMQSLGLDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQI 269
13 -48.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  1.................................MAMSSIVAIKGFNDVLPTQTAA-WRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELITARLWKRMGVDVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDS-----KIESTQKILENAPKLHDFLKEDSLS. 238
14 -48.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  16  1.....................................MIKIPRGTQDILPEDSKK-WRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYKGDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLVMHIYQSFGLHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDK-----EAIKTAPRITDFLNEESKA. 233
15 -48.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  1..................................GPMTARAVRGTKDLFGKELRM-HQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFRGGRSLTLRPEGTAAMVRAYLEHGKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVLYECLKELGLRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRI---LDSKSERDQALLKELGVRPMLDFLGEEARA. 237
16 -46.2003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  2..............................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMN...................... 219
17 -46.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  14  29VRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 259
18 -45.9003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  16  1...........................SNAMAKNDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSAQMPAIITEIFEAVNIDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTL 263
19 -45.9001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  1.................................MYRLQIEKIRGFRDFYPEDMD-VEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIASSILDRLGLQYEIRINSRKIMEEIIGGMTSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMA.......... 229
20 -44.9004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  6..............................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 206
21 -44.5003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  14  1................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRE....................................... 223
22 -44.0001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  1.......................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILALQVIEQLGLKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSG............................................. 204
23 -39.7006FTT Entity 1(prereleased)  ali follow..  4.........................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGANLLGRLSENAQQDTKIVTAIDELQRLKAHL 246
24 -39.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  4.........................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGANLLGRLSENAQQDTKIVTAIDELQRLKAHL 246
25 -36.6001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  14  2..............................................DFLDFE-------KVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLIVESASEFFEPVIVEIGHTGVYEDLLKEIP--KDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSEDSIYRRSPEHLKTMDLPLSVREDLLS.. 207
26 -34.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  36MKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERLFSGGLHPITLMERELVEIFRALGYQAVEGPEVEPEHHPARDMWDTFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSRFQPVYFPFVEPGAQFGKWLELGGAGMVHPKVFQAVDAYRERLAFGLGVERLAMLRYGIPDIRYFFGGLKFLEQFKGVL 350
27 -34.6002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  1..............MGSSSSGLVPRGSHMGTELMEKLNQQLAEETIDVISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEPKSHPARDMQDS--------FYITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSN-FAFGMGPDRIAMLKYGIEDIRYFYTNVRFLEQFK... 281
28 -33.2003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  178GSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPD-------SGHLHPLLKVRSQFRQIFLEMGFTEMPTPARDQHDTFSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELGHKVNLQMVYDSPL 492
29 -31.4005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  15  127...................................................EIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEIVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFDEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMYPQFYEYRLSDRDI 369
30 -29.0002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  1...MKFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVG-----FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKM.............. 346
31 -28.9003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  15  42MTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEPGHHPARADHDT--------FWFDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEE-IRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPE-FAFGMGMERLTMLRYGVTDLRSFFENLRFLKQFK... 327
32 -28.5004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  16  42MKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEPGHHPARAMHDT--------FYFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDSDLT-HSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPE-FAFGMGAERLAMLRYGVNDLRLFFDNLRFLGQFR... 338
33 -23.5003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7.........................................................NKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPYSEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
34 -23.3003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  7.........................................................YKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDYAEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
35 -22.6002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  8..LVPRGSHMRLSRFFLPILKENPKEAEIVSHRRAGMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIG..................................................................... 217
36 -22.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  5SSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVSDWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVA........................ 304
37 -21.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  16  5SSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGHGTEREINAAVSRFDADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHDRLQSFRMREYVCIGTPDDVSDWMVRAQAIARDLGLTFRVDYASDPFFGRVLRSEEQPTACMSFNYHREHFGTTWGIQDA---VAFGMDRLAVA........................ 304
38 -21.8003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  22  15...................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYD--MYRLMNEVDDLLQQV.................................................................................... 139
39 -21.3003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  3.............................SSSSGLVPRGSHMSETASWQPSASIPNRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYD--MYRLMNEVDDLLQQV.................................................................................... 152
40 -20.7002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  16  2..KQSKMLIPTLREVPNDAEVLSHQ-------LRAGYIRQVAAGIYSYLPLANR-VLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFSLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSK................................................................ 208
41 -20.4001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  17  114...............WRGEEEKEASEELRLKYRYLDLRRRRMQ--------ENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQMLMVA-------RYFQIARCFRDEDLRADRQPDFTQLDLEM--SFVEVEDVLELNERLMAHV.................................................................................... 261
42 -20.2005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  19  149........................HTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGID------RVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARM.................................................................................... 295
43 -20.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  147........................HLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM.................................................................................... 293
44 -20.1005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  157........................TAISGLKDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLD------KVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGL.................................................................................... 303
45 -20.0005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  18  2AMRTSQYLLSTLKETPADAVVISHQ-------LRAGMIRRLASGLYTWLPMGLR-VLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYKQPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSH................................................................ 210
46 -20.0003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  22  12..................................................YKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKRHSYEFTQLDFEIAKMKDVMRLIEELIYGLFRKA--EFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
47 -19.8001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  154........................DKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTL.................................................................................... 300
48 -19.7004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  21  152.............................LKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGID------KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQL.................................................................................... 293
49 -19.7003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  14  1MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLH-------NQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIVDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRIWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
50 -19.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  92..EVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREG-------GNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLLMVA-------RYYQIARCYRDEDFRADRQPEFTQLDMEM--SFVEADDVIAISEQVLKAV.................................................................................... 254
51 -19.6001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  154........................DKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTL.................................................................................... 300
52 -19.6003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  16  145........................EKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLE------KVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHI.................................................................................... 291
53 -19.5004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  96.....EVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFI-DLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP--QSPQLFKQLLMVA-------RYYQIAKCFRDEDLRADRQPEFTQIDIET--SFLDESDIIGITEKMVRQL.................................................................................... 260
54 -19.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  19  169........................DKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFE------RVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQA.................................................................................... 315
55 -19.4004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  14..HMASGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKVADFAPEVAWVTRLAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 224
56 -19.3004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  17  108..EVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREG-------GNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLLMVA-------RYYQIARCYRDEDFRADRQPEFTQLDMEM--SFVEADDVIAISEQVLKAV.................................................................................... 270
57 -19.3006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  21  159...............................SEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFE------RVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEV.................................................................................... 298
58 -19.3005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  21  156...............................SEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFD------RVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEV.................................................................................... 295
59 -19.3004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  134.............MILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILN-----TIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVG---------RVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
60 -19.2005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  111..EVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDD-------AAAIRLRSRVNAAARAVLARHDFVEIETPTI-----------------TRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLRYYQIARCYRDEDFRADRQPEFTQLDMEM--SFVDAEDIIAISEEVLTEL.................................................................................... 273
61 -19.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  20  6............................................IISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKDHAYEFTQLDFEVAKMEDIMRLIERLVYGLFRKA-REFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
62 -19.1004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  7....QGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 208
63 -19.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  215........................HLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGM.................................................................................... 361
64 -18.8003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  2.....AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFF-MENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDPLKIHQTCTIFRHETKNT-RVREIHWNEAHCC--HATAEDAVSQLSDYWKVI.................................................................................... 188
65 -18.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  20  93..EVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPE-------AQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQLLMMS-------RYYQIVKCFRDEDLRADRQPEFTQIDVET--SFMTAPQVREVMEALVRHL.................................................................................... 255
66 -18.5001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  17  1...............GSHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFK-IRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDPIKIYQIVNTFRYETKHTRPLKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRP.......................................................................... 195
67 -18.4003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  15  179...............................................FLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTA-QFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLKSWEEFDRMIGCSEEFYQSLGLPYRVV............................................................................. 337
68 -18.2005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  11  1...MASKENESLLGITADKITSFADWYSQVIVKSEMIEYYDISGCYILRPWSYF-IWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDPLKINQWTSIVRWEFKHP-RTREFLWQEGHTA-TRKEALEMVDIILNEYASI.................................................................................... 192
69 -17.9001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  12  7...............LTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYA-IWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAEAEEEVRRMLSIYARLAREYAA.................................................................................. 191
70 -17.8003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  14  388...................................................ANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGSATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
71 -17.5004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  166LP-LQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAV--------FRLQSGICHLFRETLINKGFVEIQTPKIISAA------SEGGANVFT-VSYFKNNAYLAQSPQLYKQMCICADFE------KVFSIGPVFRAEDSNHRHLTEFVGLDIEMAFNYH-YHEVMEEIADTMVQI.................................................................................... 327
72 -17.1005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  5.....................VTAKKSTNFADWYTQVIVRGISGCYIIRPWAYR-IWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDGFKPEVAWVTHYGDSELAIRPTSETIMYPAYAKWIRSHRDPLKLNQWNNVVRWEFKQPTRTREFLWQEGHTAHATEEEAYILELYRQWYEDYLAVPVIKGEK.......................................................................... 199
73 -17.1001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  137LP-ILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAI--------FRIQAGVCELFREYLATKKFTEVHTPKLLGAP------SEGGSSVFE-VTYFKGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNHRHMTEFTGLDMEMAFEEH-YHEVLDTLSELFVFI.................................................................................... 298
74 -17.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  16  117.....ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMM-IRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALG---------DVFCIAQSYRAEQSRRRHLAEYTHVEAECLTFDDLLNRLEDLVCDVVDRI.................................................................................... 283
75 -17.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  11  4.....................VTAKKDENFSEWYTQAIVRSISGCYIMRPWAFH-IWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDPLKLNQWCSVVRWEFKQP-RTREFLWQEGHTAHATEEEAWILELYRRWYEECLAVPVIK............................................................................. 195

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.