current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4dk3_C mol:protein length:105 RNA-editing complex protein MP81, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst RAGSNALMIGRIADVQHGFLGAMTVTQYVLEVDGGASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGYVKVVGLast
1 -68.2004dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model  100  1RAGSNALMIGRIADVQHGFLGAMTVTQYVLEVDGGASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPPLGYVKVVG 105
2 -53.0003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  31  42RCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFPGDPDKDFHTVRVFD-SDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKV. 148
3 -49.4003k81_C mol:protein length:164 MP18 RNA editing complex protein  ali model follow..  31  20KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSEVVVEKDHHTIRCFG-ELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIH 131
4 -48.9003k7u_C mol:protein length:148 MP18 RNA editing complex protein  ali model follow..  26  4KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSTQEVVVEKDHHTIRCFGEFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIH 115
5 -47.7003vdy_A mol:protein length:116 Single-stranded DNA-binding protein ssbB  ali model follow..  18  3HMFNQVMLVGRLTKDPDYTSAGAAVAHVTLAVNRNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVNVYVTEVL............. 99
6 -46.8005xgt_A mol:protein length:111 Single-stranded DNA-binding protein  ali model follow..  20  2..LNRVVLVGRLTKDPETTPSGVSVATFTLAVNRNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVV............. 96
7 -46.6005yyu_A mol:protein length:112 Single-stranded DNA-binding protein  ali model follow..  20  2..LNRVVLVGRLTKDPESTPNGVNVGTFTLAVNRNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVV............. 96
8 -46.1005yun_A mol:protein length:121 Single-stranded DNA-binding protein  ali model follow..  16  3RGVNKVILVGNVGGDPEYMPNGNAVTNITLATSETGQQQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIV--VDINGNMQLLG 113
9 -44.7001z9f_A mol:protein length:153 Single-strand binding protein  ali model follow..  18  8SFFNKIILIGRLVRDPEYTLSGTPVTTFTIAVDRAPDDAQTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRWETPTGEKRVSPEVV-----ANVVRFMD 114
10 -44.4004dni_A mol:protein length:257 Fusion protein of RNA-editing complex proteins MP42 and MP18  ali model follow..  26  144KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSTQEVVVEKDHHTIRCFGLFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIH 255
11 -43.8002vw9_A mol:protein length:134 SINGLE-STRANDED DNA BINDING PROTEIN  ali model follow..  14  2..FNKVIMVGRLTRNVEYLPSGSAAATIGLATSRDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKKNSRHTIT-----ADSLQFMD 106
12 -43.4003koj_A mol:protein length:108 uncharacterized protein ycf41  ali model follow..  16  3SHMNSCILQATVVEAPQLRYNQTPVAEMVVQFPGLSS-KDAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSLLKPDGNREKQTELT............. 96
13 -42.6003tqy_A mol:protein length:158 Single-stranded DNA-binding protein  ali model follow..  14  6RGVNKVILIGNLGQDPEYTPNGNAVANVTLATSTTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVDRYTTEII-----ANEMHMLD 113
14 -41.2001eqq_A mol:protein length:178 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  15  4RGVNKVILVGNLGQDPEYMPNGGAVANITLATSETGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVV--VNVGGTMQMLG 114
15 -40.9002hql_A mol:protein length:110 Hypothetical protein MG376 homolog  ali model follow..  10  6GMLNRVFLEGEIESSCW--SVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLE---RKSEIWKTTIE............. 92
16 -40.1005odp_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  12  25RGVNKVILIGNLGDKPEYTGSGTAVCNMSLATNEDGNEVQNTEWHDVVAWGRLGEICNEYLKKGSQVYFEGKLQTRSWEDRDNNTRYSTEVK-----AQEMMFLD 131
17 -40.0005odn_A mol:protein length:196 Single-stranded DNA-binding protein  ali model follow..  11  25RGVNKVILIGNLGDDPEYTGSGTAVCNMSLATNEDGNEVQNTEWHDVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTRYSTEVK-----AQEMMFLD 131
18 -39.6002dud_A mol:protein length:133 Single-stranded DNA-binding protein  ali model follow..  17  13RSLNRVHLLGRVGQDPVQVEGKNPVTIFSLATNELGDVSQKTTWHRISVFRGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTII-----ADNIIFLS 126
19 -39.4003ulp_A mol:protein length:124 Single-strand binding protein  ali model follow..  18  4KSLNKIMLIGRVGCEPDILNGGDKVATFSLATNETNELKSKTDWHRIVVYDQIVDLIDKYLRKGRRVYVQGSLHTRKWHDMNSQPKQITEII-LSYNKGDLIFLD 118
20 -38.8003lgj_A mol:protein length:169 Single-stranded DNA-binding protein  ali model follow..  12  15SMLNKVMLIGYLGDDPETMTSGAEVVNFRMATFETHQKVEKTEWHSVVVFNPFAKIALQYLHKGSKVYIEGKLQTRKWQDKNGHDRYTTEIV-LPQYKGELHLLD 127
21 -38.8006cqk_A mol:protein length:119 SsDNA-binding protein essential for mitochondrial genome maintenance  ali model follow..  14  2.DFSKMSIVGRIGSEFTTSANNNRYLKYSIASQPRR--DGQTNWYNITVFNEQINFLTEYVRKGALVYVEADAANYVFERDDGSKGTTLSLVQ............ 94
22 -37.9002cwa_A mol:protein length:263 Single-strand binding protein  ali model follow..  15  3RGLNRVFLIGALATRPDYTPAGLAILDLTLAGQDNGGEREVSWYHRVRLLGRQAEMWGDLLDQGQLVFVEGRLEYRQW-EREGERRSELQIR............. 100
23 -37.3003pgz_A mol:protein length:193 Single-stranded DNA-binding protein  ali model follow..  10  18GSLNKVILIGNLGADPERLNSGDQVANLRIATSETNERKERTEWHNIVIFNELVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNDRYTTEIV-LQKYRGELQMLD 130
24 -37.0002ihf_A mol:protein length:239 Single-stranded DNA-binding protein  ali model follow..  13  126RALNQVILMGNLTRDPDYTPQGTAVVRLGLAVNERRRGQERTHFLEVQAWRELAEWA-SELAKGDGLLVIGRLVNDSWTSSSGERRFQTRVE-----ALRLERPL 228
25 -35.7002fxq_A mol:protein length:264 Single-strand binding protein  ali model follow..  13  3RGLNQVFLIGTLTARPDYTPGGLAILDLNLAGQDSGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQW-EKDGEKKSEVQVR............. 100
26 -34.5001x3e_A mol:protein length:165 Single-strand binding protein  ali model follow..  15  3.GDTTITVVGNLTADPEFTPSGAAVANFTVASTPGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVE............. 102
27 -34.2001ue1_A mol:protein length:164 Single-strand binding protein  ali model follow..  14  3.GDTTITIVGNLTADPEFTPSGAAVANFTVASTPGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVE............. 102
28 -34.1001se8_A mol:protein length:301 Single-strand binding protein  ali model follow..  18  3RGMNHVYLIGALARDPEYTGNGMAVFEATVAGEDDGRERNLPWYHRVSILGKPAEWQERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVK............. 102
29 -33.7002wkc_A mol:protein length:119 ORF34P2  ali model follow..  14  1......................GTIITVTAQANEKNTRTFEKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYNFVFPTVE............. 85
30 -33.5003afp_A mol:protein length:168 Single-stranded DNA-binding protein  ali model follow..  14  3.GDTTITIVGNLTADPEFTSSGAAVVNFTVASTPGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVTGRLKQRSFETREGEKRTVVEVE............. 102
31 -33.1004gs3_A mol:protein length:107 Single-stranded DNA-binding protein  ali model follow..  14  9LENNTVTLVGKVFTPLEHELYGEKFFNFILEVPRLS---ETKDYLPITISNRLFEGM--NLEVGTRVKIEGQLRSYNKSPEEGKNKLILTVF............. 98
32 -32.2001v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  14  18.MTNRLVLSGTVCRAPLVSPSGIPHCQFVLEHRSAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDK..... 122
33 -32.1002wkd_A mol:protein length:119 ORF34P2  ali model follow..  11  1......................GTIITVTAQANEKSTAKGDKKIISVPLFEKEKGFMPDFIQMGDTVTVSGRVQAKESGEYVNYNFVFPTVE............. 85
34 -31.8005wqv_A mol:protein length:104 Primosomal replication protein N  ali model follow..  14  2..TNRLVLSGTVCRAPLVSPSGIPHCQFVLEHREAGFHRQAWCQMPVIVAGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDS........ 102
35 -31.3004apv_A mol:protein length:112 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  14  2..TNRLELSGIICRTPLVSPSGIPHCQFVLEHRSAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGDL..... 105
36 -31.1002pnh_A mol:protein length:107 Primosomal replication protein n  ali model follow..  14  5..TNRLVLSGTVCRAPLVSPSGIPHCQFVLEHRSAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDS........ 105
37 -30.5003eiv_A mol:protein length:199 Single-stranded DNA-binding protein 2  ali model follow..  16  3.GETVITVVGNLVDDPEFTPSGAAVAKFRVASTPNEWKDGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSYEDREGVKRTVYELD............. 102
38 -29.5005gqo_A mol:protein length:190 Single-stranded DNA-binding protein  ali model follow..  14  17MFETPFTVVGNIITNPVRLRGDQELYKFRVASNEGTWEPGNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYEDREGVRRSSVEV.............. 114
39 -27.4004fdb_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  14  1.AINRLQLVATLVEREVYTPAGVPIVNCLLSYSGAQTARQVEFSIEALGAGKMASVL-DRIAPGTVLDCVGFLARKHRSSKA....................... 86
40 -27.3003en2_A mol:protein length:101 Probable primosomal replication protein n  ali model follow..  14  1.AINRLQLVATLVEREVYTPAGVPIVNCLLSYSGAQAARQVEFSIEALGAGKMASVL-DRIAPGTVLECVGFLARKHRSSKA....................... 86
41 -26.6004dam_A mol:protein length:128 Single-stranded DNA-binding protein 1  ali model follow..  14  10...IMICAVGNVATTPVRDLANGPSVRFRLAVTKNAWTDGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTD-VREGQSRTSADI.............. 104
42 -26.6003fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  17  1..MNTLELSARVLECGAHTPAGLPALELLLVHESAGHPRRVELTISAVALGDLALLLAD-TPLGTEMQVQGFLAPARKDSVK....................... 85
43 -24.9003k8a_A mol:protein length:103 Putative primosomal replication protein  ali model follow..  10  5GFTNLVSLAALIEKAFPYTPAGIPVLDIILKHEENGQQCLVQLEIPARILGRQAEEWQ--YRQGDCATVEGFLAQKSRRSLM....................... 90
44 -10.5003kf8_A mol:protein length:220 Protein stn1  ali model follow..  15  85..VNQINIFGKIVYEQYKEKEFNGVEEVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYN.............................. 159
45 -10.2002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  19  69VEISQVTIVGIIRHAEK----APTNIVYKI-----DDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRIMPLEDMNEFTTHILEVINA........... 165
46 -9.2504gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  14  36..LGQLTFVAVVRNISR----NATNVAYSV-----EDGTGQIEVRQWLDSSSDDSSKASEIRNNVYVRVLGTLKMRPVIDYNEVMFHRLEAVHA........... 130
47 -9.2504hsp_A mol:protein length:150 hypothetical protein  ali model follow..  17  55...IEAKLPGYI--VPLEISEAGLVTEFLLVPYYGA--------------PPSNQIVYVKTAKGQPFWVEGTFKVENASSELAAAGYRMQASKVTP......... 144
48 -9.1502kct_A mol:protein length:94 Cytochrome c-type biogenesis protein CcmE  ali model follow..  18  9...HTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLY---------KGAVPDTFKPGVEVIIEGGLAPGE............................ 73
49 -9.0104joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  15  34HPIKQVDVLGTVIGVRERDADSTGVINCICSVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRT-----REEREIHATTYYKVDDPV....... 141

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.