current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4ex5_A mol:protein length:529 Lysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMTEPIQPQAAVAADENQIVAERRDKLRALRDQGIAYPNDFQPTHHAADLQTAYADADKEALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRREDLast
1 -167.0004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model  100  1MAMGTLEAQTQGPGSMTEPIQPQAAVAADENQIVAERRDKLRALRDQGIAYPNDFQPTHHAADLQTAYADADKEALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED 523
2 -159.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  56  1................SEQETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESI----GITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 504
3 -159.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  57  1................SEQHAQGADAVVDLNNELKTRREKLANLREQGIAFPNDFRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESI----GIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK 504
4 -157.0003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  50  1.........................SHEELNDQLRVRREKLKKIEELGDPFGKRFERTHKAEELFELYGDLSKEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSD-----EEARELAKEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK. 493
5 -155.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  36  2.................AMGTLEAQTQGPGSHYTDNRYKMMECIKDAGPFYPHKFKISMSLPAYALKYGNVENGY-IDKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDGEFSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHMLPTAISGLKDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPL-DSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVK 517
6 -155.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  39  2........................ADPSDPQEYFKLRTALINERRSKGNPYPHKFHVSISLADFIAKYNSLEKDV-ILNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHDEAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHMLPHTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHPNEVDFTPPFRKVNIYDGLQEKLGIQFPPADTDTDEANKFFDKLAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDE 512
7 -154.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  40  2..........................SVDPNQYYKIRSQAIHQLKVNGDPYPHKFHVDISLTDFIQKYSHLQPGD-HLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYQAYDVDFTPPFRRINMVEELEKALGMKLPETNLETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPED 509
8 -153.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  38  48....LSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGDPYPHKFHVDISLTDFIQKYSHLQPGD-HLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYQAYDVDFTPPFRRINMVEELEKALGMKLPETNLETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPED 577
9 -151.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  37  2..........................EVDPRLYFENRSKFIQDQKDKGNPYPHKFERTISIPEFIEKYKDLGNGE-HLEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEFAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKY-GLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKIENQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPF-DSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN 508
10 -150.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  42  2..................AMTPPESVDPDLPEQFRIRQAKRADLLAQGQPYPVDVPRTHTLLEIRQAYPDLPVDA--RTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEALDNWTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEM-SEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPPDGTVYDLDGEWESIQMYPSLSEALGEEITPDT-PAETLWAIADRLGLD--IPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKPR. 502
11 -149.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  41  2.....................AMSSAESNIPEQFRIRRDKRARLLAEGDPYPVAIERTHTLAEIRATYADLPTDS--ATEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGRESLDRWADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALRPLPVAHKEM-SEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMDGSVYDIDGEWATMEMYSSLSEALGEQITPET-TVARLRDIASGLDVEID---NSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHS 499
12 -135.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  37  2...........................MLSKQLFLNRCKDVEEYQKAGNPWPHKFNVSITVPEFIAKYSGLEKSQ--VSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYEEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGGSTKEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVFADFVTEKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPED 565
13 -100.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  29  1...........................................................................................................................................................................MGSSSSGLVPRGSHMSETASSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLVPFETRGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLD-----------------CPAAESLSYQQAFLRYLEIDPLSA--DKTQLREVAAKLDLSNVAD--TEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDR... 338
14 -95.3001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  23  1......................................................MRRTHYAGSLRETH----------VGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRSEELRLKYRYLDLR-RRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGGGVAKFLEPVREALLQATEARPGDTLLFVAGPR-KVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEK--DPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGI----GEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGK 555
15 -94.6003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  30  10..............................................................................................................................................................................................PSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLFPFETRGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ-----------------PAESLSYQQAFQRHLEIDPL----SADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDR... 325
16 -93.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  2.....................................................GMMRSHYCGQLNESL----------DGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR--AETFAKADRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQATPPFPLDEYSDVGEETRLRYRFIDL-RRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPEANLNVILDRVGAVDGDIVFFGADKA-----KIVCDALGALRIKVGHDLKLLTREWAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGI----DEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAG 564
17 -92.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  2..............GSSSSGLVPRGSHMPSASASRKSQEKPREIMDAADYAKERYGISSMIQSQERVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASQMVKFAANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPRLPEEGRATVNQDTRLDNRVIDL-RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSY--FKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPEPTLRLEYCEAL-----------------------AMLREAGVEMGDEDDLSTPNEKLLGHLVEKYDTDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKR. 512
18 -90.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  22  2........................................................RTEYCGQLRLS----------HVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR--ADALKLASELRNEFCIQVTGTVRARATGEIEVLASSLTIINRA-DVLPLDSNHVNTEEARLKYRYLDL-RRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGL---TDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGI----NEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAA 561
19 -87.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  1...............GPGSMAATQEKKPQLPPVVLLKTPELVSGENFKMPMHQSQPCYKTGLKYTE----IEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETSKEFVQFCQKISAESICDITGIVKAVEKQDVEIHVTSIAVVSLAEYPLPAQKYVKVSQDTRLDNRMLDL-RTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKY--FDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKPFEDLIYRPFLRLTYKEAIE-------------------MLRASGETIGDYDDFT---TPQEVKLGELIKAKYNTDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEK------GVDPAT--LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIR. 545
20 -87.1004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  21  2.......................................AMGTLEAQTQGPGSMVLRTHAAGSLRPAD----------AGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQAGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGV 577
21 -86.8004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  3................................................PEFSSFVVRTNTCGELRSSH----------LGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKKPFEIKNFVKKTEALRLQYRYLDLR-SFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTL-FKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATL-------LKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGH 572
22 -86.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  1......................................EDTAKDNYGKLPLIQSRDSDRTGQKRVK----VDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKEGTNMVKWAGSLNLESIVLVRGIVKKVDEPNLEIHITKIYTISETPEALPAAGLPVVNLDTRLDYRVIDL-RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTY--FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRL----------TYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVR---DKYDTDFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAH------GLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKR. 487
23 -84.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  3........................................................RTHAAGSLRPAD----------AGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQAGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPFGSDKPDLRFGIELVECTEYFKDLLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGV 561
24 -84.1001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  25  1......................................................MYRTHYSSEITEEL----------NGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKFEILPEKIVVLNRAETPLPLDPTGKVELDTRLNNRFMDL-RRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKY--FEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHNAKELNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDID----------------------TEGERLLGKYMMENENAPLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES--------FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRR. 435
25 -81.9005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  19  3..............................SSSSGLVPRGSHMAKKITI---------KNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQCYN---GVLLSTESSVAVYGMLNLTPKGKQALSCDFWELIGLAPAGGADNLIEESDVDVQLNNRHMMI-RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDY--FGEEAFLTQSSQLY-LETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDV---------------------KKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP--------YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQR. 463
26 -80.9005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  2..........................................GSSSSGVPRGSHVLRSHAAGLLREGD----------AGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ-DTEVLAQAHRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGEC-APLPFQLDEPAGEELRLKYRYLDL-RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTGPVAKNLTEAERTGLADHVGAKPGDCIAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGL----DKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG.. 578
27 -80.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  18  23........................................................................RDAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCE--PEKVKLLTRECSLEITGRLNAYAGLNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVI-RSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQY--FNEPAYLTQSSQLY-LESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNK----------------------DKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP---------YWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLER. 453
28 -80.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  21  1................................................................MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEETFEKAKKLGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHI-RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPIL--VTGAVEGGATLFKLKYFDKYAYLSQSAQLYLE-AAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLEPPFPRISYDEAIDILQSKGV---------------------------NVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPN----DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDY-EWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPAR. 431
29 -79.3001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  24  1......................................................MYRSHFIADVTPEY----------DGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKN---SSAFGISQELTQESVIQVRGIVKADKRAPIELHAEEITLLSKAKAPLPLDVSGKVKIDTRLRERVLDL-RRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAGGAQLFPVIYFGK----EAFLAQSPQLY-KELMAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGD--------------------------DIGTPELRILNEELKEDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES---------EFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKR. 426
30 -78.7002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  19  6........................................................................RDLVKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQTYD---ALTVNTECTVEIYGAIKEVPEGKEALIADFWKIIGNAPPGIDNVLNEEASVDKMLDNRHLVI-RGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDY--FGEQSFLTQSSQLYLETC-IPTLGDVFCIAQSYRAESRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPERPFLRMEYKDAIKWLQEHNV---------------------ENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP--------YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGR. 434
31 -76.7001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  25  6........................................................................RDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL----------KLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPTPPKEEWRANPDTLLEYRYVTL-RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKV--VRAGAEGGSGLFGVDYFEKRAYLAQSPQLY-KQIMVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTAGDELGATWPSFPQDIPRLTHAEAK-----------------------RILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYT-YPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA---------HGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHR. 419
32 -57.6002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  16  3...........................................................................................................................SSSSGLVPRGSHMFLTRRDQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAALVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGL------------------GFGLERLLMIREGTQHVQSMARSLSYLDGVR.............................................................................................................. 298
33 -47.7003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  23  2.......................................................................................................................................................................................NAVEI--SRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKA-----EEWTGREFPRARHFKVYDYKDILEEFGS------------------------------------------DEKASMEMEEPFWIVNIPREFYD---REENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---------RPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP...... 285
34 -45.4001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  22  2.......................................................................................................................................................................................NAVEI--SREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKA-----EEWTGREFPKTKRFEVFEYSEVLEEFGS------------------------------------------DEKASQEMEEPFWIINIPREFYDR---EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS---------RPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFP...... 285
35 -39.9004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11  4......................................................................................................................................................................................DGYSSYV--LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSGFEKAIPNASFEVVHSLAKWLANYKFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILP----ETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSL-EVSSMGIRVNAEALRHQISLTGDDSLLKSE--HQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWP...... 341
36 -39.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  2..........................................................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELESELLSRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL---------------GIDFKIVGDSCMVFGDTLDVMHGDL-----------------------ELSSAVVGPRPLDREWG------IDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST.................................................................................. 283
37 -37.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  18  7...............................................................................................................................GLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELESELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPL----------------------------------------------------------------------------------------------------------------------DREWGIDKPWI-----------GAGFGLERLLKVKHDFKNIKRA.......... 271
38 -36.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  7...............................................................................................................................GLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELESELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLGI----------------------------------------------------------------------------------------------------------DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA.......... 271
39 -34.10011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  13  1.........................................................................................................................................................................................MKTAYIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGDGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALREDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDG-----------------HRHDVRAPDYDDWSTPSELGHAGLNGD--ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE---------EWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQVWP...... 319
40 -26.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  17  8...............................................................................................................................................QTDRLEVLLNPKDEISL--------NSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHLGI----------------------------------------------------------------------------------------------------------DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGID----------------------KPWIGAGFGLERLLKVKHDFKNIKRA.......... 254
41 -26.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  14  4...............................................................................................................................GLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISL------NSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRK---KIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL------------------------------------GIDFKIVGDSCMVFGDTLDVMHGDLEL--------SSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST.................................................................................. 280
42 -25.6004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  13.............................................................................................................................................................VLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCT--RENLESIITDFLNHLGIDFKIVGDSCSV-----------------------------------------------------------------------------------------------YGDTLDVMHGDLELSSA-------------VGPIPLDREWGID-----------------KPWIGAGFGLERLLKVKHDFKNIKRAA......... 254
43 -22.9004gla_C mol:protein length:109 OBody NL8  ali model follow..  20  1...............................................GSVYPKK---THWTAEITPNL----------HGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGRGVEIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................ 107
44 -20.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  19  3......................................................PKKTHWTAEITPNL----------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................ 107
45 -20.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  20  3......................................................PKKTHWTAEITPNL----------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEAGWDTGVEIFPSEIWILNKA-KPLP................................................................................................................................................................................................................................................................................................................................................................... 111
46 -19.6004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  18  5.......................................................KKTHWTAEITPNL----------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEASEATGVEIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................ 108
47 -19.5004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  19  25........................................................................................................................................................................NSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL................................................................................................................................................................................................................ 184
48 -17.5005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  15..........................................................................SEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS---SKAYEKALEVRSEFVLVAKGKV-KLKTGKIEIVLEELIIENKS........................................................................................................................................................................................................................................................................................................................................................................ 109
49 -17.2004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  18  8.......................................................KKTHWTAEITPNL----------HGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAAVEIFPSEIWILNKA........................................................................................................................................................................................................................................................................................................................................................................ 112
50 -12.5002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  3..........................................................................................................................................................SSSSGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPAITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIK-MSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTG---------------------------------WIEILGAGMVHPNVL--------------------------------------------------------------EMAGFDSNEYSGF--------AFGMGPDRIAMLKYGIEDIRYF.......... 269
51 -10.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  15  1......................................................................................................................MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELN-AALEAALEAREKALEEAALKEALERERTLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMRLLLRTHTSPMQVRYMVAHTPRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGMAHLKGAIYELAQALFGP---DSKVRFQPVYFPFVEPGAQFAVW---------------------------------------PEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTG-------------------------------------------------------------------AFGLGVERLAMLRYGIPDIRYFF......... 336
52 -10.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  29.............................................................................................................................................................................................MQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWA-KAAESTQVGIERIGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVS----HARLVPRLLDALGIS-ASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRS-----------REASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSG---------ASDVVTFDLALHRELDYGL-PAVGFAFEVERVMAVLEAQEEGEG........... 371
53 -10.3003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  11  2.............................................................................................................................................................NAMAKNDKINFSTPSGFPE-----------------LPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRFRQFRQCDI---VVGREKLSLLYDAQMPAIITEIFEAVNIG------DFVIRINNRKVLTGFFQSLNIS-ETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGR-----EELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTL.......... 367
54 -9.9703hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  35...................................................................................................................................................................................................ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRKWYSIPQCWRYEAITRGRRREHYQWNM--------DIIGVKSVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKM-------------EKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIE-------------------------AYGFGDWVIFDASVVRGLAY---PCVGFGFGDCVIVELLNEKKLLPE........... 351
55 -9.8203kf6_A mol:protein length:159 Protein stn1  ali model follow..  16  48................................................................................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKI-NSFRSEVELIAQSFEELR.......................................................................................................................................................................................................................................................................................................................................................................... 127
56 -9.7203hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  35...................................................................................................................................................................................................EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGK--KWYSIPQCWRYEAITRGRRREHYQWNM--------DIVGVKSVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEK---------IPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGR------DNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPD........... 351
57 -9.5404g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  33...............................................................................................................................................KQQKASAELIEEEVAKLLKLKAQLGPD-ESKQKFVLKTPKGTRDYSPRQ-----MAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRD------NPAMTR-EFYQCDFDIAGNFDIPDAECLKIMCEILSSLQIG------DFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLEALE........... 412
58 -9.0904g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  26...................................................................................................................................................................................................RQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDF-PMIPDAECLKIMCEILIGDFLVKVNDRRILDGMFAICGVSDSKFR-TICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYL-----TLFGIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLEALE........... 359
59 -9.0201nnx_A mol:protein length:109 Protein ygiW  ali model follow..  14  27.....................................................................TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNG------VTVTPKDTVEIQGEV-DKDWNSVEIDVKQIRKVNP......................................................................................................................................................................................................................................................................................................................................................................... 109
60 -9.0203pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  15  3..................................................................................................................HLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVIN-EQVQQALNARKAELESAALNARLAAETTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAPGRVYRNDYDQTHTPMFHQMEGLIVDTNIS-FTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWL--------------------------------------------EVLGCGMVHPNVL--------------------------------------------------------------RNVGIDPEVYSGF--------AFGMGMERLTMLRYGVTDLRSFF......... 316

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.