current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4fkc_A mol:protein length:377 Xaa-Pro aminopeptidase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MRGSGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITLLast
1 -110.0004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model  100  1MRGSGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL 371
2 -102.0001wn1_A mol:protein length:356 dipeptidase  ali model follow..  51  1..........MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFP--ATFWHDGENPYAKLREILEELGISKGRILIED-TMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRE--LSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL 356
3 -102.0001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  40  1........MKERLEKLVKFMDENSIDRVFIAKPVNVYYFSGTSPLGG----GYIIVDGDEATLYVPELEYEMAKEESKLPVVKFKKFDEIYEILKNT--------ETLGIEGTLSYSMVENFKEKSNVKEFKKIDDVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMN-GAEKPAFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVVGSPNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGDYFIHSLGHGVGLEIHEWPRISQYDETVLKEGMVITIEPGIYIPKLGGVRIEDTVLITENGAKRLTKTERELL.. 348
4 -101.0001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  39  4........MNEKVKKIIEFMDKNSIDAVLIAKNPNVYYISGASPLAGG----YILITGESATLYVPELEYEMAKEESNIPVEKFKKMDEFYKALEGI--------KSLGIESSLPYGFIEELKKKANIKEFKKVDDVIRDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMN-GAEKPAFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVVGSPNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGEYFNHSLGHGVGLEVHEWPRVSQYDETVLREGMVITIEPGIYIPKIGGVRIEDTILITKNGSKRLTKTERELI.. 351
5 -98.8003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  34  2.......NAMEKIERLRSAFDEAGIDGILLTNEHSRRYMANFTGTAG-----VVLISKKRAQFITDFRYVEQASKQAVGYEI-VQHAGLIIDEVAKQVKELGI--QKLGFEQDTLTYSSYSAHKEAIDAEFIPTSGLVEKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQ-GATSSSFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGEPSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGEYFGHSTGHGIGLEIHEAPGLAFRSDTVLEPGMAVTVEPGIYIPGIGGVRIEDDIIVTSEGNEVITKSPKELIIL 356
6 -98.5005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  31  1.........SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDG----KVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTV------RGLRVGFEESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRA-GGES-AFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV.. 349
7 -98.2002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  32  2..........DRSERLIQLISEEGIDAFLIMNIENSAYFSGFTGSFS-----IILISENTRLLITDSRYTVQAKQETDFEVR-EVKGGDFIDVLKKTVNDLKI--KTIALEERVSLSLFRRISSAFGDRKFIGIDDEVKQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKE-GAEGVAFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSIGEPSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGEFFGHSLGHGIGLEVHEGPAISFRNDSPLPENVVFTVEPGIYLEGKFGIRIEEDVVLKEQGCEILTTLPRSIFVV 359
8 -96.8004zng_C mol:protein length:362 Prolidase  ali model follow..  32  2..........SKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGDIFGYEDSQNPWEVVKNHVKS---DVKSIAVESDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFAAERNGVTESDIVAKIEYEMKRM-GVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF 362
9 -96.4005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  29  1.........STLLASLRDWLKAQQLDAVLLSSRQNKQPHLGISTGSG-----YVVISRESAHILVDSRYYVEVEARAQGQLHLLDATNTLTTIVNQIIADEQL--QTLGFEQQVSWETAHRWQSEL---NAKLVSATPDVLRQIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQ-GAEKASFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNAESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGDYFGHNTGHAIGIEVHEDPRFSPRDTTTLQPGMLLTVEPGIYLPGQGGVRIEDVVLVTPQGAEVLYAMPKTVLLT 358
10 -95.1004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  28  25AAPIGADEYQQRIERARVLMRAQGVDALLIGAGTSLRYFSGVPWGAS-ERLVALLLTTEGDPVLICPAFEEGSLDAVLQRKRLWEEHEDPYALVVQAMDEQHA--HALALDPGIAFAVHTGLRAHLG-TAIRDAGAIIDGCRMCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHR-ALGADNGSTFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIYGTPSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGPDYPHRTGHGCGLAIHEAPYLVRGNRQPLQPGMCASNEPMIVVPGAFGVRLEDHFYVTDTGAQWFTPPSVAID.. 396
11 -88.9004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  37  8.GRFDTAVYARRLAAAAAATEQAGLAGLVITPGYDLRYLIGSRADTF-ERLTALVLPASGVPTIVLPRLELASLKESAACVRDWVDGDDPYQLVAVALGGAP---AATAVTDSMPALHLLPLADALG-VLPVLATDVLRQLRMVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAE-GHSAVAF-VIVGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGDPSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAEYFVHRTGHGIGLCVHEEPYIVAGNELPLVAGMAFSIEPGIYFPGRWGARIEDIVVVTENGALSVNNRPHELMVV 376
12 -84.8001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  17  15RSTFSAQEYANRQARLRAHLAAENIDAAIFTSYHNINYYSDFLYC-SFGRPYALVVTEDDVISISANIDGGQPWRRTVGTDNIV--TDWQRDNYFAAIQQALPKARRIGIEDHLNLQNRDKLAARYPDAELVDVAAACMRMRMIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIAVELMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDHCSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLQYRTFGYGHSFGTLSHYYGELREDIDTVLEPGMVVSMEPMIMLPGAGGYREHDILIVNENGAENITKFPYGPEKN 398
13 -83.5001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  16  16YTPFSXAEMTRRXXRLRAWMAKSXIDAVLFTSYHNINYYSGWLYCY-FGRKYAXVIXXVKAVTISKGIDGGMPWRRSFGXNIVYTDWKR--DNFYSAVKKLVKGAKXIGIEDHVTLXHRRXLXKALPGTEFVDVGXPVMWXRVIKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRX-IARXFPYVELFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFLXXVXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFGYGHSFGVLXHYYGELREDIXTVLEPGMVVSMEPMVMEPGAGGYREHDILVIKENXTENITGFPFGPEHN 398
14 -76.9005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  22  2.........STPIPAMQAALAATDLDGWLVYDFQGARRVLGIGDDVFLTRRFFVWVPRAGRAVVLHNHIEGGNWNRITQEWDAELRPFGSHAELDAALRGV-VSGQRLAMESPNGAVPYVSRVDAGTGAAEVASSADLLQAFLVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAA-GMQA-GHDVNVSFGVNAADSHYEPSEQRLHPGECVLIDLWAQEPGRFADVTWVGFAGEPGTEYLDAWQAVRAAREAALELLRSRFVAEELDRAARDAMGE-RWAPHFLHRTGHDLGVQIHGAGAYETRDTRTLTPGLSVTVEPGTYPAGGFGIRSEVDVYLAPDGPEVTTDLQQAPFIL 400
15 -74.0004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  15  73........RRFRHRRLTDHVVARGYAGLLMFDPLNIRYATDSTNMQTHNPFRATLLCADGYMVMWDYKNSPFLSEFNPLVREQ-VAADVFANEVRILLRDHAPGLRRLAVD-KVMLHGLRALQA--QGFEIMDGEEVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRR-GGEWIET-RLLASGPRSNPWFQECGPRVCQRNEIISFDTDLVAYGICTDISRSWWIGDQKPRADMIYAMQVEHIRTNMEMLKPGVMIPELS--ANTHVLDAKFQKQKYGCLMHGVGLCAYPDHAVAGAYDYPLEPGMTLCVEALISEEGGDSIKLEDQVLITEDGYENLTKYPFDPALM 461
16 -73.0004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  15  56........REYRWKRLTQAIVDRGYGGLLMFDPLNIRYATDSTNMQLHNPFRAVLLCADGYMVIWDYKNSPFLSKFNPLVREQ-VQADVFANEVRVLMQDHAPGHTRLAVD-KIMLHGLRALEA--QGFEIMEGEEVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVGEDDIWAVLHAENIKR-GGEWIET-RLLASGPRTNPWFQECGPRITQKNEIIAFDTDLISYGICVDISRTWWIGDQKPRPDMVYQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDD--KFQAQKYGCLMHGVGLCAYPDKAVPGSYDYPLEPGMVLCVEAAVEVGGDFSIKLEDQVLITEDGYENLTTYPFDAALM 444
17 -67.3003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  17  7..EIDEITFHKRLGILLTSWKNQDCDSILVTSTALHTWLLGYEFPST-----LILLEKHRITILTSVNKANMLTKLAETKLKRTKDAEENKKLFEKIIEYIRATNKKVGVQGKFINEWDSIFEPVKSEFNLVDASLGLAKCLAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNDLDQLEWCYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFD-PDSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAPDLEPNFVRNLGAGIGIEFRESSLVNAKNPRVLQAGMTLNLSIGFSQSKEYALLLIDTIQITRSDPIVFTDSPKAQGDI 437
18 -66.9006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  15  6..IIDFSTFENRLLALRDRFPSGSPSSLVFITTILHNWLLGYEFPTT-----LIAVFKEGCVVITSAAKTRYLEEGVAQMNKK-KEPGHNLKLFEDLVERVREAGSAVGLATK-EWKGVWDTAVEKHGLNGVDVSLGLSSLWAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKDVNYLDWAYSPIIQSGPKYDLRVSRSSETQLDGNGCILASCGIRYKNYCSNISRTFLID-PSDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSPELSAGFTKNVGSLMGLEFRDSQFVNKNDYRKVENGDCFNISLGFNTGASYALQLADTVQLTSGGPKVLTNYTKSRSQI 441
19 -64.7005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  19  23..SIDLNTFQTRLKAFYSHWDDRRTDLRYLKSTALFLWLLGFEFPET-----IMVFTKKQIHVLCSQKKASILESGVEIILHVKPKNDDGASSMDAIIRAIRAQSKSDGHDSEGRLLDLWAEKLKNSKFRLSDVANGFSALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKILHSTLMEEKADNVDICYPPIFQSGGKFDLRPSAVSNDEYDSASVIICAVGARYKSYCSNIARTFLID-ADPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDDMVSCLTKSAGTGIGIEFRESGNINAKNDQIVKEGMVFNVSLGFQNLKVFSLLLADTIIINKDKTDVVTSIGSKAL.. 451
20 -64.2005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  20  4..TLDKDAYYRRVKRLYSNWRKVDEEIVYAKSTALQTWLFGYELTDT-----IMVFCDDKIIFMASKKKVEFLKQIANTKGNENSNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFEKVRHSKLAESVEKAIEEKKYLDPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVD-PSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKLLNKITKNLGFGMGIEFREGSLINSKNQYKLKKGMVFSINLGFSDEKTYALFIGDTVLVDEDGPATVTSVKKKVKNV 428
21 -61.2003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  17  7..NIDFDVFKKRIELLYSKYNEFSPNSLLFVTTILHNWLLSYEFPAT-----LIALVPGKVIIITSSAKAKHLQKAIDLFKDP-ELNKKLFDDVIALINSAGKTVGIPEKDSYQEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVTNAKLSDKIENKIDDNFDLLDWTYSPIIQSGKKFDLRSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLID-PSEEMANNYDFLLTLQKEIVNILKPGRTPKEVYESVIEYIEKTKPEPNFTKNIGSLIGLEFRDSNFIVKNDYRKIQRGDCFNISFGFNNLKNYALQLADTVQIPLDETEFLTNYTKAKSQI 445
22 -60.0002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  22  19...VPLALFALNRQRLCERLRKNP-GSIVVLQESFFHWAFGVTEPGDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPAGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEE-GAVFMPHGLGHFLGIDVHDVGGYPEGVERHLQPGMVLTVEPGIYFIGFGGVRIEEDVVVTDSGIELLTCVPRTVEEI 476
23 -60.0003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  22  1...MKSKFFAQNRERLVNTLPDESITILFFVPNRNFYYVTGID-FGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECTKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSS-GIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPAGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGELSKYYYHGVSHFLGLDTHD---VGTYKDRVLEEGMVITIEPGLYIEEESGIRIEDDILVTKDGHENLSKIIREVEEI 408
24 -59.8001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  24  1.SEISRQEFQRRRQALVEQMQPGSAALIFYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVV-VNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRH-GARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSG-HRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDIGIRIEDDIVITETGNENLTAVVKKPEEI 430
25 -59.2005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  26  1MIRIPKSEYARRRKALMAQMEPNSIAIL-YRQDSDFQYLTGFP-----EPEAVMALIPGEYVLFCRERWDGLRAGQDGAIGQYGADDAFPIGDIDDILPGLIEGRDRVYYADWINVIRSKARQGAQPPNEFVALDHLLHDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKG-GAKMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPAGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAG-YKAFYMHRAGHWLGMDVHDVGEYRVGGEWVLEPGMAMTVEPGIYIAPDIGVRIEDDVVVTRNGCEVLTNVPKTVAEI 432
26 -58.6004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  24  1...MTQQEYQNRRQALLAKMAPGSAAIIFYRQNSDFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRWFGRRLGQEAAPTKLAVDRALPFDEINEQLYLLLNRLDVIYHAAALEKLRHGFRKNLRAPATLTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRH-GARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVG-HRPFFMHGLSHWLGMDVHDVGDYGSDRGRILEPGMVLTVEPGLYIAP--GIRIEDDIVITATGNENLTAVVKDPDDI 429
27 -57.9005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  25  16...LSQVEYALRRHKLMSLIQKEAQDQTVVVQDNNFLYLCGFQ-----EPDSILVLQSLPGKQLPSHKWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRAR-GADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQK-ARKYCPHHVGHYLGMDVHDTPDMP--RSLPLQPGMVITIEPGIYIPED-GVRIEDDVVVTQDSPLILSACPKEMNDI 448
28 -53.6004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  17  4LASLYKNHIATLQERTRDALARFKLDALLIHSGPQFKAWVPVTQVPN----CWLLVDGVNKPKLWDYWHNVEPLPTSFWTEDVEVIALPKADGIGSLLPAARGNIGYIGPV----PERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHR--DTDVPYSNIVALNEHAAVLHYTKLDHQPEEMRSFLLDAGAEYNGYAADLTRTW--AKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKL-TGPFMPHGIGHPLGLQVHDVAGFMQDDSRILQPGMVLTIEPGIYFIESGGIRIEDNVVIHENNVENMTRDLKL.... 442
29 -52.9004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  16  4LAVLYAEHIATLQKRTREIIERENLDGVVFHSGQAKAWLPVID-----NPHCWIVANGTDKPKLIDFWHKVPDEPNEYWADYFDIELLVKPDQVEKLLPYDKARFAYIGEYLEVAQ------ALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH--SENDTPFGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQT-TSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYFIDSGGIRIEDNIIVHEDSLENMTRLELD.... 440
30 -52.4003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  18  4LAVLYAEHIATLQKRTREIIERENLDGVVFHSGQAKAWLPVID-----HCWIVANGTDKPKLIFYRPVDFWHKVPDEPNEYWADYFDIELLVKPDQVEKLLPYDKARFAY---IGEYLEVAQALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH--SENDNPYGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG-EGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCDEIVAKGITSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYFIDSGGIRIEDNIIVHEDSLENMTRELRLRLTT 443
31 -51.6003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  18  4HKATYQQHIEELQARTREALQREGLDGLVIHSGQGKAWVPVIDNPNC---WLVVNGVDKPTLIFYRPEDFWHKVPPEPNDFWTDSFDIKLLQQADAVEKFLPYDKSRFAY---VGEYIEVAKALGFDNVNPDRVLHYLHYQRAYKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQ--GDNDVPYTSIVALNEHASILHYMQCDTVAKESRSFLIDAGANYHGYAADITRTYAQEGNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQI-TRTFFPHGIGHFLGLQVHDVGGLVNDDRRMVEARQVFTIEPGLYFIPFGGIRIEDNIIVHRDKNENMTRLDLNL... 444
32 -48.0005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  22  196..KYNGACAGEKIDKLKQSLMIKNVDNLLLSELDEIAYLLNLRGYD----YSYLLFQFDREEQDFSKIVFFTTVKNLPADVKNLLEINKEYEEIVPYLRDVVIPSIPKHNDDNPDFKKYDMIYKLFDRKNVLLQNSPVVKMKAVKNDVEIDNMKQAHILDGLALLQFFHWCEQNETEMSLRHKVDYFRSTKKNFIFPSFSTISASGPNAAVIHYECTDKATIKPAIYLLDSGGQYLHGTTDVTRTTHFGEPTAEEKRIYTLVLKGHLRLRKVIFAYTNSSALDFIARENLFNNFMD--YNHGTGHGVGLNVHEGGSIGPVGGAPLKKNMVLSNEPGYYMKDKFGVRIENMQYVISKSFDDLTMYPYEKKLL 603
33 -47.5004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  22  187..EDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSD----YSYLFVAMREIHVFIDNKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNY--AIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKEYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPGIYGSRLDTLTRDALWKLGLD--FEHGTGHGVGLNVHEGPI-SVPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEATFKSLTLVPIQTSIV 582
34 -46.3003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  18  3..........................................................................................................................................GSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYS-VVRDYTGHGIGRVFHDKPSIRNGTGLTLKEGMFFTVEPMINADKSLSAQFEHTIGVTKDGFEIFTLSPKK.... 256
35 -45.9003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  20  172..DYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPGTKGHLLDSFARSALWDSGLD--YLHGTGHGVGLNVHEGPSYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVTLEPLTLVPIQTKMI 572
36 -45.5004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  25  5...............................................................................................................................................IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFS-VVREYCGHGIGKVFHEEPQVRAGTGIELKEGMIFTIEPMINQDRKLSAQWEHTVLVTADGYEILTLRNDE.... 253
37 -45.1003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  23  1............................................................................................................................................MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAQGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYG-VVRDFVGHGIGPTIHESPMIEAGKGLRLKEGMVITIEPMVNTDGGLSCQYEHSLAITKEGPRILTSQGEELTYL 255
38 -44.1001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  28  2..............................................................................................................................................IVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPNFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLK-VIKNLTGHGVGLSLHEAPYFDPKDKTLLTEGMVLAIEPFISSDKSFVAQIEHTVIVTKDGPILTTKIEEE.... 252
39 -44.0001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  24  2.......................................................................................................................................GSDKIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFGYKYATCVSVNEEVVHGLPLKKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFN-VIRDYVGHGVGRELHEDPQITPGTGVVLRKGMTLAIEPMVSEDGSRCAHFEHTILITENGAEILTK........ 254
40 -43.9004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  25  5...............................................................................................................................................IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSAGYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS-VVREYCGHGIGQGFHEEPQVSRETNVVLKPGMTFTIEPMVNADRSLSAQYEHTIVVTDNGCEILTLRKDD.... 254
41 -43.5001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  22  40..............................................................................................................................................WVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYN-VVRDFTGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILTCL....... 285
42 -43.3003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  22  39..........................................................................................................................................GSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYN-VVRDFTGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILTCL....... 288
43 -43.2004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  19  46..........................................................................................................................................TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDS.... 298
44 -43.2002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  20  68..............................................................................................................................................KLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDS.... 316
45 -43.0004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  25  1............................................................................................................................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFGAMMDYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLGGPGGLADSCWAYAVGTPSEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYG-VVRDLVGHGVGPTMHEEPMVIAGRGLRLREGMVLTIEPMINTDGGLSCQYEHQFVITKDGPVILTSQGEE.... 283
46 -43.0004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  19  17.................................................................................................ITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCS-VVRTYTGHGVGHLFHTSPTVNNKSLGMMRPGHVFTIEPMINLDGRRSAQFEHTMVVTNGGVEIFTDWVDG.... 310
47 -41.8003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  21  4.......................................................................................................................GTLEAQTQGPGSMVGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIGHGIGRSMHLDPFLAPGKGPLLAVGSVLAIEPMLTLDGSRAAHWEHTVAVTEAGPRILTMRP...... 280
48 -40.6004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  20  129..............................................................................................................................................KLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDS.... 377
49 -37.3003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  22  96..............................................................................................................................................YVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFS-VVRSYSGHGVGKLFHSNPTVKNKAVGIMKPGHVFTIEPMINQDGKLSAQFEHTLLITNNGVEILTKRTQD.... 347
50 -31.0002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  27  2....................................................................................................................................................DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGG--KPAFPVNLSI--NEIAAHYTPDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVG---MEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGF-KPIVNLSGHKIEYKLHAGISIRPHDNYVLKEGDVFAIEP-FATIGAGQVIARFLLAKIKREYGTLPFAYRWL... 240
51 -30.6003pn9_A mol:protein length:138 Proline dipeptidase  ali model follow..  19  2.......NAMSKLQQILTYLESEKLDVAVVSDPVTINYLTGFYS-DPHERQMFLFVLADQEPLLFVPALEVERASSTVSPVVGYVDSENPWQKIKHALPQLDF--KRVAVEDNLILTKYHGLKTVFETAEFDNLTPRIQRMRLIK.................................................................................................................................................................................................................................. 138
52 -29.9003il0_A mol:protein length:131 Aminopeptidase P; XAA-pro aminopeptidase  ali model follow..  24  3.......AMQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNA-----TVFITKNRRLFLTDSRYTLIAKQSVHGFDII--ESKDPLKDIVKFVEVDKL--ETIGFDNQVSFAYYQALQAIFEGYTLSPQTNFMEELRMIK.................................................................................................................................................................................................................................. 131
53 -28.0003ovk_A mol:protein length:132 AMINOPEPTIDASE P, Xaa-Pro dipeptidase  ali model follow..  19  1.SNAMSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAA-----TVLITAKRRVLITDSRYTLLAKASVEGFDII--ESRTPLKVVAELLEADQI--DCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR..................................................................................................................................................................................................................................... 132
54 -27.7003peb_A mol:protein length:137 Dipeptidase  ali model follow..  17  2.......NAMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPHERQMFLFVYENREPALFVPALEVARASSVLDFPVFGYVDSENPWQKIKAGLASTDI--PIIYAEDNLNVTKFQGLQTVFE-GRFENLTPFIHKMRVIK.................................................................................................................................................................................................................................. 137
55 -27.5003i7m_A mol:protein length:140 Xaa-Pro dipeptidase  ali model follow..  20  2........HMTKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFG-SDPIERVLALVVFPDQDPFIFAPALEVEVIKETGFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEGQLQVARMEALAAQFSAPSFLDITSFIEHMRG.................................................................................................................................................................................................................................... 139
56 -26.9003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  16  39...............................................................................................................................................FTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGEGIGFPAGMS---NSCAAHYTVNDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFK---ENLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYEVEI-ISDLHGHSISQFRIHGPAVNNRDTTRIKGDSFYAVET-FATTGKGSIDDRP...................... 257
57 -26.6001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  16  160...............................................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLAFPTGCS---NNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDIRNLNGHSIGQYRIHAPIVKGGEATRMEEGEVYAIETGHYMKNFDVGHVPIRLPRTKHLLNVINENFGTL... 413
58 -25.8005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  16  54...............................................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLAFPTGCSL--NNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN---PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEKPIRNLNGHSIGQYRIHAPIVKGGEATRMEEGEVYAIETGHYMKNFDVGHVPIRLPRTKHLLNVINENFGTL... 307
59 -25.2002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  17  5...............................................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKKGIAFPTSISVNNCVCSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDV-LVSSGEGKAKDAGQ..................... 235
60 -25.2003o5v_A mol:protein length:132 X-PRO dipeptidase  ali model follow..  19  2.........NAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAA--KTIYAEDHLNVNKFHGLQTIFS-GQFNNLTPYVQGMR..................................................................................................................................................................................................................................... 132
61 -25.1003ooo_A mol:protein length:132 Proline dipeptidase  ali model follow..  20  3..........SKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSV--SKVLAEDNLNVTKFQGLQTVFD-GHFENLTPYIQNMR..................................................................................................................................................................................................................................... 132
62 -24.3003qoc_A mol:protein length:135 Putative metallopeptidase  ali model follow..  15  4..PLADTRFLQRRRALSAQLAAKRIDAMLVTHLTHIRYLSGFTGSNA----ALIINKDLSARISTDGRYITQIAEQVPDIESLMARNC------APALLSDINGPKRVGFEADLSVSQCEELRKSASDVELIPVTGAIEKLR..................................................................................................................................................................................................................................... 135
63 -23.8002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  17  13...............................................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKKGIAFPTSISVNNCVCSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDV-LVSSGEGKAKDAGQ..................... 243
64 -23.3005e2c_A mol:protein length:132 Xaa-Pro dipeptidase  ali model follow..  17  2.........NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNG---ALLVFADERDAVLATDGRYRTQAASQAPDLEVAIE--RAVGRYLAGRAGEAGV--GKLGFESHVTVDGLDALAGALENTELVRASGTVESLREV................................................................................................................................................................................................................................... 132
65 -22.7005fl8_u mol:protein length:380 ARX1  ali model follow..  17  5...............................................................................................................................................ILQESVLNKYRTAGQIAQTALKYVTSLINDSYHDSFILTRLEQYYKNKVNERGIAIPTTIDIDQISGCPEIDDVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDEGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNC-GVVPGSRVRRIRRFLAGQNEGIPSDDFVVQSGEVYLIDL.................................... 237
66 -22.2004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  14  1..................................................................................................................................MGMATEKKEADNVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSKKGFSHPTTVS---AAFITPYTPAATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDRQADLFLATYYANEVLLRLMVPPPSQAKISSLLEKVAKAYDC-NIIESTTSWLFD-EIEGKKKINIKGEGVPEVGDVWGVEV-GCSLGSGKVKQFE...................... 262
67 -20.6004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  13  1..............................................................................................................DYDIPTTENLYFQGAMALAISHEDTQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLIQRQLTVPELCLLTDSFILTRLEQRGIAIPTTID---DQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIL-DAVAAAHIASLGGTSSGITGQLIRTIVDTIARSYNCG--VPGSRVRRIRRFLAGQVAEREYKGVVWTESHQEADLL.................................... 294
68 -20.4005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  12  27......................................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEQRGIAIPTTID---DQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIL-DAVAAAHIASLGGTSSGITGQLIRTIVDTIARSYNC-GVVPGSRVRRIRRFLAGQVAEREYKGVVWTESHQEADLL.................................... 296

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;