current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst GPGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLLast
1 -132.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  97  54AQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL 517
2 -131.0004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model  100  1GPGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL 464
3 -107.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  31  1..SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDAEKDKSGDTGSEARALKFDQTVPLAAYIARHLTFPFARYQMDVVFRGERA--KDGRFRQFRQCDIDVVGREKSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEK-EGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSLPESEQFNLGVSELETVITGVRNLGVPDRFCIDLAIARGLNYYTGTVYETTLIGHEA--------LGSICSGGRYEELVGTFIG--EKMPGVGISIGLTRLISRLLKAGILNT--LPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNF-EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT... 465
4 -106.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  25  10TQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGLLPAKWYSIPQCWRYEAI--TRGRRREHYQWNMDIVGVKSVS-AEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAV-LGLEPTVVDAITTTLSLKSIDEIAQRVGEEH---------EAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDRE---------GKFRALCGGGRYDNLLTTYGSP-TPIPCAGFGFGDCVIVELLQEKRLLPD---IPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIIL-DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL...... 446
5 -104.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  26  10TQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARQLLAKGLLPAKWYSIPQCWRYEAI--TRGRRREHYQWNMDIIGVKSVS-SEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAA-IGLESNVVDAITSTLSLKTIDEIAQRIGEEH---------EAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRD---------GNFRALCGGGRYDNLLTTYGSP-TAVPCVGFGFGDCVIVELLNEKKLLPE---LHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVF-DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPVD..... 447
6 -101.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  24  2.........YRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKQRPLRWYSFPKVWRYEEP--QAGRYREHYQFNADIFGSDSPE-ADAEVIALASSILDRLGLQDYEIRINSRKIMEEIIG--GMTSSDPFSVFSIIDRYHKISREEFVDQLRS-AGIGEDGVSMIADLCSGTRGIDEMARI--------TGKSSEEIARMAAVEDLLASYGVKN-VRYDFSIVRGLSYYTGIVFEAYDRS---------GQFRAILGGGRYDNLASLMSG--ESVPAVGFGMGDAVISLLLKRENVQIP----REKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEI-MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLE. 428
7 -98.6001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  22  1............MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQPIKLYYNGPMFRYERK--QKGRYRQFNQFGVEAIGAENPS-VDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCK-------------------VDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIP--YTEDPNLVRGLDYYTHTAFELMMDNPNYDG-----AITTLCGGGRYNGLLELLDG--PSETGIGFALSIERLLLALEEEGIELDIE---ENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDY-LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK...... 420
8 -97.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  22  2.........AMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLATPRVWYMGPMFRYEKP--QKGRYRQFHQFGVETFGVATPD-IDAELIMLTARLWKRMGVDHVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLT--------------TNPLRILD-----SKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIK--FVINQKLVRGLDYYNKTVFEWTTTALGSQ--------GTVCAGGRYDGLVGQLKGKAQSVPAVGFAMGMERLLLLLEQVEQAEI-----VRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK.. 432
9 -97.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  22  2...PGYQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLQEQRLWYIGPMFRHERP--QKGRYRQFHQLGCEVFGLQGPD-IDAELIMLTARWWRALGIEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMY--------------TNPLRVLD-----SKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIA--YTVNQRLVRGLDYYNRTVFEWVTNSLGSQ--------GTVCAGGRYDGLVEQLGG--RATPAVGFAMGLERLVLLVQAVNPEFKAD---PVVDIYLVASGADTQSAAMALAERLRDPGVKLMTNH-GGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG... 431
10 -97.6004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  21  1.........GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMQPVRLWMAGPMFRAERP--QKGRYRQFHQVNYEALGSENPI-LDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLK-----------------ELGVRPMLDFLGEEARAHLKEVERHLERLSVP--YELEPALVRGLDYYVRTAFEVHHEEIGAQ--------SALGGGGRYDGLSELLGG--PRVPGVGFAFGVERVALALEAEGFGLPEE---KGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYAL-APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG... 423
11 -95.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  20  14.GSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTKEMYSFVDANGENLTLRPENTAAVVRAAIEHNMGPKRLWYIGPMFRHERP--QRGRYRQFHQVGVEALGFAGPD-ADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDD--------------DAQRRLYTNPLRVLD-----TKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVP--FTINPRLVRGLDYYNLTVFEWVTDKLGAQ--------GTVAAGGRYDPLIEQLGG--KPTAACGWAMGIERILELLKEEHLVPE----QEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMVAT. 455
12 -88.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  19  1....SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSRAYPLRLAYQSNVYRAQQN--EGGKPAEFEQLGVELIGDGTAS-ADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSL----NLSTIDKSRLMNLLSLRGGRA---AIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLG----------VPLCSGGRYDELLSKFHR---PAQATGFGVRIDLLVEALNGEII-------SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQD-LAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA................................ 400
13 -82.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  22  10AWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESRDWIRLFDGGGDAVALRPEMTPSIARMAAPRGRTPIRWCYCERVYRRTDDPAASGKAAESTQVGIERIGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSP-SREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLADVVTFDLALHRELDYYTGLVFEMFAPGVG----------APIAQGGRYDELLAQFGA---GAPAVGFAFEVERVMAVLEAQEEGEGE........................................................................................................ 372
14 -76.8006FTT Entity 1(prereleased)  ali follow..  15  3...............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGGIARYCYAGDVIHTLPS--GLFGSRTPLQLGAEIFGCESIA-ADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGS--------DFYTLARFGHDIANLLGRLSEN-AQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSET----------QPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFI-----VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDGLTHRLSLADNQWRLHAV.......................................... 388
15 -76.8005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  3...............LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQTGRLMGIRADITPQILRIDAHHGGGIARYCYAGDVIHTLPS--GLFGSRTPLQLGAEIFGCESIA-ADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGS--------DFYTLARFGHDIANLLGRLSEN-AQQDTKIVTAIDELQRLKAHLQVQW-QCAVSIDVTELSGYHYHTGIVFNGYINSET----------QPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFI-----VLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDGLTHRLSLADNQWRLHAV.......................................... 388
16 -72.6001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  16  3GSGSIEGRMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDTSARYSYFGKIFRKEKR--HKGRSTENYQIGIELFGESADK-SELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTEL---LLKKDLSGLNAFIEKNNFSK-----------ELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQ----------PILSGGRYDQLLSNFQE---EAFAIGFCCHMDTILKALERQELEEDND....................................................................................................... 338
17 -62.5001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  19  2.....................DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP---------AGNFFLDRKGNLFSIREDFTKTVLNHRKRYSPSQIKVWYADFVYRYSGS-----DLVAEYQLGLEKVPRNSLD-DSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDLLK--EIPKDLHEKVLNLIDTKNLAEIEFLSHMK----KIDLSRVEKIIEDSIYRRSPEHLKTM---------DLPLSVREDLLSASSFLQEKFPTVSVEIDLTLARTIEEYCGLIFTIYDTSSS----------RLVAAGGEYTVNGE---------KGVGGSIFLEGK..................................................................................................................... 273
18 -51.4002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  70  1................................................................................................................................................................................................................................................................................................................AERAALEELVKLQGERVRGLKQQKASAELIKAQLGPDESKQKFVLKTPKALE---EKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL 167
19 -44.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  31.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDPDPIKIFEIGPCYRKESD--GKEHLEEFTMLNFCQMGSGCTR---ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDK.................................................................................................................................................................................................................................................................. 229
20 -42.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  48.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRAPIKIFEIGPCYRKESD--GKEHLEEFTMLNFCQMGSGCTR---ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAGPRPLDREWGIDKPWIGAGF............................................................................................................................................................................................................................................................. 253
21 -41.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  45.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRAPIKIFEIGPCYRKESD--GKEHLEEFTMLVFWQMGSGCTR---ENLESIITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVIPLDREWGIDKPWIGAGFGLER......................................................................................................................................................................................................................................................... 254
22 -37.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  31.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRAPIKIFEIGPCYRKESD--GKEHLEEFTMLAFAQMGSGCTR---ENLESIITDFLNHLGI-DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDK.................................................................................................................................................................................................................................................................. 229
23 -35.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  30.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDPDPIKIFEIGPCYRKESD--GKEHLEEFTMLNFFQMGSGCTR---ENLESIITDFLNHLGI-DFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDK.................................................................................................................................................................................................................................................................. 228
24 -34.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  18  48.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRAPIKIFEIGPCYRKESD--GKEHLEEFTMLNFCQMGSGCTR---ENLESIITDFLNHLGIDFKIVGDSC..................................................................................................................................................................................................................................................................................................... 212
25 -30.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  48.....RELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRAPIKIFEIGPCYRKESD--GKEHLEEFTMLSFIQMGSGCTR---ENLESIITDFLNHLGIDFKIVGDS...................................................................................................................................................................................................................................................................................................... 211
26 -28.5002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  48..............QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWSGRYDAYGPEMLRIADRHKRELLYGP-ITEIFRAYIKSYKSLPLNLYHIQWKFRDERPRFGVMRGREFLMKDAYSFDVDEAGARKSKMFVAYLRTFARMGLKAIPMRAETGPI---------------GDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIE---------------------VGQIFYF---------------------GTKYSDSMKA-DGTDAPIHGGSYGVGVSRLLGAIIEACHDDNGPEAVAPFRVTILNLKAATDAACDQLYRELSAKGVDVLYD-DTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT....... 452
27 -27.5005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  16  36..............RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWSGRWEQYGPELLRLKDRHEREFCVGPVITDLARNELNSYKQLPINFYQIQTKFRDERPRFGLMRGREFIMKDAYSFHLSQDSLQQTGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATIAALVDGFQLPINEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGA--DPSPDGKGTLVIKRGIEVGHI--GTKYSEAMKL-QGKPVNLIMGCYGIGVSRVVAAAIEQNHDERGPSALAPFQIALVPLTESVKQATDKLYAELTAAGFEVLLDDRDKKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR.. 573
28 -27.3002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  14  34..............QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWSGRYETYGPNLYRLKDRNDRDYILGPTFTELIRDEINSYKRLPLNLYQIQTKYRDERSRSGLLRGREFIMKDGYSFHADEASLDQSDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETTIAEVANFFEVEPQNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIDLAVQDLANAIVGA--DPSPDGNGVLAFTKGIEIGHI--GTRYSDAMGA-NGREKSVIMGCYGIGVSRLLSAIVEQNADER-PTGIAPFDLHVVQMNEYQTKLSQEVEAMMTEAGYEVLVD-DRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMNT.. 567
29 -27.2002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  11  81........................VKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLPIRIFEIGTCYRKESQ--GAQHLNEFTMLNLTELGTPLE--RHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMK......................................................................................................................................................................................................................................................................................... 239
30 -24.0004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  13  26.................PGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWSGHWQHYSENMFSFEVE-KELFALKPMNCPGHCLMFDHRRELPLRLADFGVLHRNELSGALTGRVRRFQQDDAHIFCAMEQIEDEIGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGD-------------------------------------------------------------AFYGPKIDIQIKDAIGR-LDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILG------------------------SVERMIAILTEN----------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEF.. 400
31 -23.8004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  19..............ELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWSGHWQHYSENMFSFEVE-KELFALKPMNCPGHCLMFDHRRELPLRLADFGVLHRNELSGALTGRVRRFQQDDAHIFCAMEQIEDEIGCLDFLRTVYSVFGFSFKL--------------NLSTRPEKFLGDIEVWDQAEK------------------------------------------------------------QLENSLNEFGE------KWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIAILGSVERMIAILTEN----------SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEF.. 396
32 -23.2004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  12  55...........IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKTHVADFAPEVAWVTRSGEPIAIRP-MYPAYAKWVQSHRDLPIKLNQWCNVVRWEKHPQPFLRTREFLWQEGHSAFATMEEAAEEQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSH-----------------------------------------------------------------------------------LGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTR---TIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK----------EALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED.. 424
33 -22.8005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  22.......RSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDH-SPEVAWVTHYGDSPIAIRPTMYPAYAKWIRSHRDLPLKLNQWCSVVRWEKQPTPFLRTREFLWQEGHTAHATEEEAWELDILELYRRWYEECLAVPVIKGEKS-----------------------------------------------------------------------------------------------------------------EGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEI-EGHKRLVHQTSWGCTTRSLGVMIMTHGDDKG-PPRVASVQVVIIPILGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEG.. 389
34 -22.6004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  12  39...........IEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTADFAPEVAWVTRSGEPIAIRP-MYPAYAKWVQSHRDLPIKLNQWCNVVRWEKHPQPFLRTREFLWQEGHSAFATMEEAAELQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSH-----------------------------------------------------------------------------------LGQNFSKMFEIVFEDPKIPGEKQFAYQNSW---GLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK----------EALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED.. 408
35 -22.6003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  29.......FNREFATFTGAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFSGHIEFYRNNMYLFDIE-GHEFAVKP-LFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSGSIYGRVRGFTQDDAHIIVPGGRVIDVVDVFEEMKLVLERLFK-TFKVRLSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEKLDFIMMVEESGVSKEWQMGTIQ----------------------------------------------FDFNLPRRFRLYDVVREEFGIEEVYIIHRALLG------------------------SIERFLGVYLEH----------APIQFAVIAVKTEIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVEN.. 441
36 -22.6005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  27...........VEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDH-KPEVAWVTHYGDSELAIRPTMYPAYAKWIRSHRDLPLKLNQWNNVVRWEKQPTPFLRTREFLWQEGHTAHATEEEAYTLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQ---------------------------------------------------------------------------------------ATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWG-----------------------CTTRSLGVMIMTHGDDKG-PPRVVAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLET.. 390
37 -22.5005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  12  23.......KAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEPEVAWVTRAGDTEVAVRP-MYPYYAKWIRSHRDLPVRLNMWNNVIRWESHPTPFIRTREFLWQEGHCAWAKAEECAKLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSH-----------------------------------------------------------------------------------LGQNFGKMFDIRFQDPENNEQTLIPWQNSW---GLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTTEEAR----------QELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDV 398
38 -22.5004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  12  19..............EEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWTGHWDNYKDAMFTTSSE-NREYCIKPMNCPGHVQIFNQGRDLPLRMAEFGSCHRNEPSGSLHGRVRGFTQDDAHIFCTEEQIRDEVGCIRLVYDMYSTFGFEKIVVKLSTRP------KRIGSDEMWDRAEADLAVALEENNIPFEYQL--EGAFYGPKIEFTLYDCLDRAWQCGTVQ----------------------------------------------LDFSLPSRLSASYVGEDNERKVPVMIHRAILG-------------------------SMERFIGILTEE-FAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKAD-LRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRS.. 395
39 -22.3004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  11  30...........IEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNH-SPEVAWVTKYGDSEIAIRP-MYSVFPKWIRSYRDLPLKLNQWNTVVRWEKQPTPFIRTREFLWQEGHTAHKNEEEAVKLDILDLYRRWYEEYLAVPIIKGIKSEG-----------------------------------------------------------------------------------------------------------------EKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKI-NEVKQYVHQTSWGCTTRSIGIMIMTHGDDKG-PPNVSKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVD.. 393
40 -21.8005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  11  34...........IEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEPEVAWVTKSGKSDIAIRP-MYPYFAKWIRSHRDLPLKINQWTSIVRWEKHPTPFIRTREFLWQEGHTAHSTRKEALEMIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQA--------------------------------------------------------------------------------------ATSHLLGQNFS------------------------MFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHG-----PPKVAPVQVIIIPIIEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEE.. 397
41 -21.7001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  13  23......QKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEH-SPELAVVTHAGEEPLAVRP-IGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHTAHATREEAEEERMLSIYARLAREYAAIPVIEGLKTE---------------------------------------------------------------------------KEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFD-------------IKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVI---------------VPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLAS-RLGGKETLPLAALPEALPGKLDA.. 387
42 -21.4001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  11  261.................AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYSGHWDHYQEDMFPPMLDETESMVLRPMNCPHHMMIYANKRELPIRIAELGTMHRYEASGAVSGRVRGMTLNDSHIFVRPDQIKEEFKVVNMIIDVYKDFGFEDYSFRLS-YRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAI--EAAFYGPKLDVQVKTAMGKEETLSTAQ----------------------------------------------LDFLLPERFDLTYIGQDGEHHRPVVIHRGVVS-------------------------TMERFVAFLTEETKGAFPTWLAPKQVQIIPVNVDLHYDYARQLQDELKSQGVRVSID-DRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRL.. 641
43 -21.3003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  10  36..............YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDH-EAECFWVEQPLEERLALRP-IYSMFSKWVRSYKDLPLKIHQTCTIFRHEKNTKPLIRVREIHWNEAHCCHATAEDAVSQDYWKVIDTIFSDELCFKGQKLRRVCW---------------------------------------------------------------------------DRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSS--------TFDILYANKANES-------------------------VHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESADTLKSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVRDVGKDQKRVIPITEVMKVSSHTTEN.. 402
44 -20.3001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  14  52..............YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIH-EDEVYWVTSKLQRKLALRP-MYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLVREITTFKEAHTIHATASEAEEERAVEIYKEFFNSLGIPYLITRRPPWD----------------------------------------------------------------------------KFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFE-------------IKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVI---------------VPIIFKKAAEEVMEACRELRSRLEAAGFRVHLD-DRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKD.. 408
45 -19.8001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  12  258..............EEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWTGHWDNYKDAMFTTSSE-NREYCIKPMNCPGHVQIFNQGRDLPLRMAEFGSCHRNEPSGSLHGRVRGFTQDDAHIFCTEEQIRDEVGCIRLVYDMYSTFGFEKIVVKLSTR-------------PEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGA-----------------------------------------------YGPKIEFTLYDCLDR-LDFSLPSRLSASYVGEDNERKVPVMIHRAILG-------------------------SMERFIGILTEE----------APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKAD-LRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRS.. 634
46 -19.8001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  12  29.................QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYSFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNSRKLGFGIAQIGKAFRNETPRNFIFRVREFEQMEIEYFVRPGEDEYWHRWVEERLKWWQEMGLSRENLVPYQQP-----------PESSAHYAKATVDILYRFPHG-----SLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLA---------------------------------------EAFTREELPNGEERIVLKLKPQLAPIKVAV-----------------IPLVKNRPEITEYAKRLKARLLALGLGRVLY-EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR... 441
47 -18.7001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  15  25..............YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEEDEVYWVTHGGKTQLDVKLALRP-IYYMMKLWVKVHTDLPIKIYQIVNTFRYEKHTRPLIRLREIMTFEAHTAHSTKEEAENKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEY------------------------------------------------------------------------------------TMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDK-------------------------DYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLKEDIVMEKAKEIYEKLKGKFRVHID-DRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNN.. 381
48 -18.6001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  12  1......................................................................................................................................................................................................................................................................................................................................................................GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTESLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYERYK 109
49 -18.4003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  45..............PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWSGHWENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKKNELPLRFSDFSPLHRNEASGALSGRLRKFHQDDGHIFCTPSQVKSEINSLKLIDIVYNKIFPFVKGGSGAESNY---------------------------------------FINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGA------------YGPKLDIMVTDHLRK-LDFQLPERFDLKFKDQDNSYKRPIMIHRATFG-------------------------SIERFMALLIDS----------NPYQAVIIPVNTKNVQQLDMCPVPLNDWHFNVDLD-IRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEKN.. 452
50 -16.2001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  11  104.....KEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNSRKLGFGIAQIGKAFRNETPRNFIFRVREFEQMEIEYFVRPGEDEYWHRWVEERLKWWQEMGLSRENLVPYQQ-----------PPESSAHYAKATVD-------------------------------------------------------------LYRFPHGSLELEGIAQRTDFDLGSHTK---DQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVL-KLKPQLAPIKVAVIPLRPEITEYAKRLKARLLALGLGRVLY-EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR... 504
51 -14.7002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  13  90................VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTS-GHVDKFADFMVKDVKNGECFRADIFLNFKRLLEFNQGKPFAAAQIGNSFRNESPRSGLIRVREFTMAEIEHF-SAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIV-------CADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDKRFQKTLYVEEVVPNV--SFGLGRIMYTVQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVD-DSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGNI 660
52 -14.6003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  15  15...........................IDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMG-----KIFVLSPNIRLESRRKDDGRH-EFTQLDFEI-----EGAKMKDVMRLIEELIYGL-----------RKAEEWTGREFPRARHF--KVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSS--GGEREWEYEKIVAKIRAAGLKED---------SFRPYLEIA--------------------------RAGKL-----------PSAGAGIGVERLVRFI................................................................................................................. 272
53 -14.4001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  13  15...........................LDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMG-----KIFVLSPNIRLESRQKDDGRHYEFTQLDFEV-----ERAKMEDIMRLIERLVYGL-----------RKAEEWTGREFPKTKRF--EVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVAS--GGEREWEYEKIVAKIRKAGLNED---------SFRPYLEI---------------------------KAGKL-----------PSAGAGIGVERLVRFI................................................................................................................. 272
54 -12.2003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  11  15.........................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAG-----PVFQLCRSFRNEEMGRHHNTMLEWYRPHYDM----------YRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLE--------IDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTED-----------RVAERFEV---YYKGIELANG--FHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAA-DCSGVALGVDRLVMLALGAESLAD......................................................................................................... 317
55 -12.1003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  11  28.........................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAG-----PVFQLCRSFRNEEMGRYHNTMLEWYRPHYDM----------YRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLE--------IDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTED-----------RVAERFEV---YYKGIELANG--FHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKV-DCSGVALGVDRLVMLALGAETLAE......................................................................................................... 330
56 -11.9003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  11  220...VKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS------SEGGSNIFEV-KYFDRKAYLAQSPQLYKQMAIMGD-----KVFEVGPVFRAENSNTRR-HLTEFEGLDIEMEIVEN------ECIDVMEKLFTFI-----------DEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDD--------TPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDI---------DPNYSNSYDVFVR---------------------QEITSGADPEFLMKRCIEKGVDWPHAGCGIGLERITMLY................................................................................................................. 527
57 -11.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  12  132...KDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ------CEGGSTLFKLQYFNEPALTQSSQLYLESVIASLG------KSFCMLSSYRAEQSRTVR-HLAEYLHLEAEL-----PFISFEDLLNHLEDLVCTV--------------IDNVMAVHGDKIRKMNPHLKLPTRFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKV----------------HPDLTESVDLLMPGVGE-------------------IVGGSNYDELMGAYKANGLNCPHGGYGLGVERLVMWL................................................................................................................. 435
58 -11.6005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  140...EESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ------VEGGATLFKLDYFGEEALTQSSQLYLETCLPALG------DVFCIAQSYRAEQSRTRR-HLAEYTHVEAEC-----PFLTFDDLLNRLEDLVCDV--------------------VDRILKSPAGSIVHELNPNFQPPKRPFKR-------MNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKYMQRCPEDSRLTESVDVLMPNVGE-------------------IVGGSDSEEILAGYKREGIDCPHGGYGLGLERFLTWI................................................................................................................. 445
59 -11.6005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  11  94.................GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGD--SKEQLVAFLENVLKTSGKLRENLLHGALEHYVNNKRLPYGLAQIGVCFHPVFDTKQIRSIGEKTEASLVWFTPPRTSNQ-DFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGR-----------------------------------------------------------------------------------------KGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSK--------------------LHGRDGRKNVVPCV--NGDLDRGMLAYNLHRKVLKLHPCLAPIKVALDVGTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA. 482
60 -11.5001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  10  118.EEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAG-----RYFQIARCFRDE--DLRADRQPDFTQLDLEM-----SFVEVEDVLELNERLMAHVELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPL-VLNGVEVGGGSIFRLLGIGEEEQREKFGFFLEALEYG-----------------PHGGIAWGLDRLLALMTGS---------PSIREVIAFPKNKEGKDPLTGAPSPVPEEQLR..................................................................... 571
61 -11.4001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  17  285.........................................................................................................................................................................................................................................................................................................................................GRKNVVPCV--SGDVDLGTLAYSLQRKVLKLHPCLAPIKVALDVGTVELRQVCQGLLNELLENGISVGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASA. 440
62 -11.3002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  11  77.................GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGD--SKEQLVTFLENVLKTSGKLRENLLHGALEHYVNNKRLPYGLAQIGVCFHPVFDTKQIRSIGEKTEASLVWFTPPRTSNQ-DFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGR-----------------------------------------------------------------------------------------KGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSK--------------------LHGRDGRKNVVPCV--NGDLDRGMLAYNLHRKVLKLHPCLAPIKVALDVGTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA. 465
63 -11.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  12  110...EEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ------VEGGSTLFNL-DYFGEQSFLTQSSQLYLETCIPTLG----DVFCIAQSYRAEKSRTRR-HLAEYAHVEAEC-----PFITLDDLMEKIEELVCDT-------RLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAI---------------------KWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKYMQRDAKDNTLTESVDLLMPGVGE-------------------IVGGSKFDELSKAFKNVEIDCPHGGYGLGLERFICWL................................................................................................................. 416
64 -11.1004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  186...ATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKI------ISAASEGGANVFTV-SYFKNNAYLAQSPQLYKQMCICAD-----KVFSIGPVFRAEDSNTHR-HLTEFVGLDIEMAFNYH------EVMEEIADTMVQI-QERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVE-----MGDEDDLSTPNEKLLGHLVKEKYDTDFY--ILDKYPLAVRPFYTMPDPRNPKQSNSYDM------------FMRGEEILSGAQRIHDPQLLTERALHHGIDLEK------IKAYIDSF--RFGAPPHAGGGIGLERVTMLF................................................................................................................. 494
65 -11.1001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  111...EQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPIL------VTGAVEGGATLFKL-KYFDKYAYLSQSAQLYLEAAIFGLE----KVWSLTPSFRAEKSRTRR-HLTEFWHLELEA-----AWMDLWDIMKVEEELVSYM-----------QRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPK-----------HIKAFYMKEDPNDPRKVLASDMLAPEG--------------------------YGEIIGGSDYDKLLNRILEEGMDVPHSGFGLGVERLVAWV................................................................................................................. 413
66 -11.0003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  18  295.........................................................................................................................................................................................................................................................................................................................................GRKNVVPCV--NGDLDRGMLAYNLHRKVLKLHPCLAPIKVALDVGTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA. 450
67 -11.0004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  18  303.........................................................................................................................................................................................................................................................................................................................................GRKNVVPCV--NGDLDRGMLAYNLHRKVLKLHPCLAPIKVALDVGTLELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA. 458
68 -10.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  13  157...PVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKL------LGAPSEGGSSVFEVT---KGKAYLAQSPQFNKQQLIVAD-----RVYEIGPVFRAENSNTHR-HMTEFTGLDMEMAFEEH------EVLDTLSELFVFIKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKE-VRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAIHDHALLQERMKAHGLSPEDPGLKDYCDGFSY------------------------------G---------------PPHAGGGIGLERVVMFY................................................................................................................. 469
69 -10.7005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  135.................................DIDEEKKERLREVLHLYKKGAIDGDDLVFLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLIKKRKLPLKLFSIDRCFRREQ-REDRSHLMSYHSASCVVVGEDVSV---DDGKVVAEGLLAQFGFTKFKFKPDEK------YYTPETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVPVMN-VERLAMIIYGYEDVRAMVY--------------PQFYEYRLSDRDIAGMIRVDKVPILDEFYNF-ANELIDICIANKDKESPCS------------KREFNFNGERRVIKVEIFENEPNKKLL-------GPSVLNEVYVYDGNIYGIPPTFEGVKEQYPILKKAKEEGVSTNIRYIDG------IIYKLVAKIEEALVSNVDEFK---FRVPIVRSLSDINLKIDELALKQIMGENKVI 538
70 -10.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  11  113...EQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGME--RYYQIARCYRDE--DFRADRQPEFTQLDMEM-----SFVEADDVIAISEQVLKAVDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLFTAPKPDSVDTFDSDPGNALSDAYDIVCGGGKFGFLLDAFSYGAP--PHGGIAFGWDRITALLAG-------------------------------------VDSIREVIAFPKSGGGVDPLTDAPAP-------ITPQQRKESGIDAKPREDKPKEDAKSKAAAA.......... 601
71 -10.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  11  132...EPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYAL-PQSPQLFKQLLMVAGME--RYYQIARCYRDE--DFRADRQPEFTQLDMEM-----SFVDAEDIIAISEEVLTELGTDKPDLRFGTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSG-GHEIGGGKFGFLLEAFMFGAP--PHGGIAFGWDRTTALLAG---------MDSIREVIAFPKTGGGVDPLTDAPAPITAQQRK..................................................................... 596
72 -10.5001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  12  114...HVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYAL-PQSPQLFKQLLMMSGFD--RYYQIVKCFRDE--DLRADRQPEFTQIDVETYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGG-DMTAAELKAAPENAVANAYDMVINEVGGGSVRIPHAGLAFGLDRLTMLLTG-------------------------------------TDNIRDVIAFPKTTAAACLMTEAPSF-------ANPTALAELSIQVVKKAENN..................... 590
73 -10.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  12  101...WRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKV------VRAGAEGGSGLFGVDYFEKRALAQSPQLYKQIMVGVFE------RVYEVAPVWRMEEHHTSR-HLNEYLSLDVEMGFIAD------DLMRLEEALLAEM--------------------LEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRSFDL---LFRGLEITSGGQRIHRYEELLESLKAKGMDPEA------FHGYLEVF--KYGMPPHGGFAIGAERLTQKL................................................................................................................. 401
74 -10.2005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  12  176.........................EVARQRIAVIRAVRNALERRGFLEVETPMLQTLA------GAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGG-----RVFELNRVFRNE--GSDSTHSPEFSML--ETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHR-----SIPGVTEKWDL---YVRGVELATG--YSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALE--PCTGTGMGIDRLLMCLTGLSI............................................................................................................ 486
75 -10.2001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  16  112..KVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKI------IATATEGGTELFPM-KYFEEDAFLAESPQLYKEIMMASG-----RVYEIAPIFRAEEHNTTR-HLNEAWSIDSEMAFIED------EVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRV-SYDKALEILGDLGKE-----IPWGEDIDTEGERLLGKYMMENENAPLY--FLYQYPSEAKPFYIMKYDNKPEICRAFDL------------EYRGVEISSGGQREHRHDILVEQIKEKGLNPES------FEFYLKAF--RYGMPPHGGFGLGAERLIKQM................................................................................................................. 417

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.